BLASTX nr result
ID: Rehmannia28_contig00040610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00040610 (410 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44263.1| hypothetical protein MIMGU_mgv1a020197mg [Erythra... 54 5e-07 ref|XP_012856092.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [... 54 5e-07 >gb|EYU44263.1| hypothetical protein MIMGU_mgv1a020197mg [Erythranthe guttata] Length = 110 Score = 54.3 bits (129), Expect = 5e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -1 Query: 170 MWPEVQRPTXXXXXXAGVGLRWCDSPFPFIIGGVALMLGVVPVALVLIIACSF 12 M P+V+ P AG G RW +SPF FI G+ALMLG++PV L+L +ACS+ Sbjct: 1 MIPKVEGPAAVAAAPAGGGTRWWNSPFTFIFSGLALMLGIIPVVLML-LACSY 52 >ref|XP_012856092.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [Erythranthe guttata] Length = 114 Score = 54.3 bits (129), Expect = 5e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -1 Query: 170 MWPEVQRPTXXXXXXAGVGLRWCDSPFPFIIGGVALMLGVVPVALVLIIACSF 12 M P+V+ P AG G RW +SPF FI G+ALMLG++PV L+L +ACS+ Sbjct: 5 MIPKVEGPAAVAAAPAGGGTRWWNSPFTFIFSGLALMLGIIPVVLML-LACSY 56