BLASTX nr result
ID: Rehmannia28_contig00039702
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00039702 (408 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084409.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-14 ref|XP_012853250.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-13 >ref|XP_011084409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Sesamum indicum] Length = 772 Score = 77.4 bits (189), Expect = 4e-14 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = +1 Query: 220 MRFKQLHTSSLCLLPNRTRIHAQSAAPPRRNTSDFFKSPTTKSLPEPRTKKVTDSDIVKC 399 M FK+LHT++ L NRTR AQ+ PPR+N +FFK PT KSLP+ R+ K TDSDIVKC Sbjct: 1 MSFKRLHTTTFRSLRNRTRTDAQT--PPRQNAGEFFKPPTNKSLPKLRSNKFTDSDIVKC 58 Query: 400 NIA 408 NIA Sbjct: 59 NIA 61 >ref|XP_012853250.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Erythranthe guttata] Length = 773 Score = 75.5 bits (184), Expect = 2e-13 Identities = 38/63 (60%), Positives = 45/63 (71%) Frame = +1 Query: 220 MRFKQLHTSSLCLLPNRTRIHAQSAAPPRRNTSDFFKSPTTKSLPEPRTKKVTDSDIVKC 399 MRFK LHT++L NRT HAQSA PPR+N DFF+ PT +S P + + TDSDIVKC Sbjct: 1 MRFKHLHTTTLRSFHNRTTTHAQSAKPPRQNIRDFFEPPTDQSKPR-SSNRFTDSDIVKC 59 Query: 400 NIA 408 NIA Sbjct: 60 NIA 62