BLASTX nr result
ID: Rehmannia28_contig00037924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037924 (438 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23044.1| hypothetical protein MIMGU_mgv1a008123mg [Erythra... 55 2e-06 gb|EEF47027.1| Nudix hydrolase 20, chloroplast precursor, putati... 55 3e-06 ref|XP_015572522.1| PREDICTED: nudix hydrolase 20, chloroplastic... 55 3e-06 >gb|EYU23044.1| hypothetical protein MIMGU_mgv1a008123mg [Erythranthe guttata] Length = 384 Score = 55.5 bits (132), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = -3 Query: 265 FVCIQAQPHGISCEDNIVKECEEEAGIPRSISCK 164 F+C PHGISC +N+VKEC+EEAGIPRS+S K Sbjct: 250 FLCSLGSPHGISCGENLVKECKEEAGIPRSLSSK 283 >gb|EEF47027.1| Nudix hydrolase 20, chloroplast precursor, putative [Ricinus communis] Length = 329 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 244 PHGISCEDNIVKECEEEAGIPRSISCK 164 PHGISCE+N++KECEEEAGIPRSIS K Sbjct: 244 PHGISCEENVIKECEEEAGIPRSISHK 270 >ref|XP_015572522.1| PREDICTED: nudix hydrolase 20, chloroplastic [Ricinus communis] Length = 371 Score = 55.1 bits (131), Expect = 3e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -3 Query: 244 PHGISCEDNIVKECEEEAGIPRSISCK 164 PHGISCE+N++KECEEEAGIPRSIS K Sbjct: 244 PHGISCEENVIKECEEEAGIPRSISHK 270