BLASTX nr result
ID: Rehmannia28_contig00037912
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037912 (408 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090097.1| PREDICTED: helicase protein MOM1 [Sesamum in... 59 1e-07 >ref|XP_011090097.1| PREDICTED: helicase protein MOM1 [Sesamum indicum] Length = 2380 Score = 58.9 bits (141), Expect = 1e-07 Identities = 44/108 (40%), Positives = 58/108 (53%), Gaps = 13/108 (12%) Frame = +1 Query: 124 DVVPLTRQHAEDKNPSKGECVQGNYVAPSDTSVSNA--------PIGTPINLVSINPQIE 279 +V P+ QH ED+NPS+ C + N V PS TS S P+G NLVS+N Q + Sbjct: 1632 NVRPMFGQHVEDRNPSERFCPEENNVVPSITSTSTPAEALGCRNPVG---NLVSVNSQNK 1688 Query: 280 VGLTFSERSI--LVEQINQP---NLTGEIICANLPVTGEKVPDEMGSV 408 VGL ERS +V+ ++QP N GE +LP E V E+ SV Sbjct: 1689 VGLMSLERSSMPMVDHLDQPTNSNDVGETGLPDLPAPVEYVSGEIQSV 1736