BLASTX nr result
ID: Rehmannia28_contig00037769
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037769 (436 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848542.1| PREDICTED: pre-mRNA-splicing factor CWC22-li... 98 3e-22 ref|XP_011096444.1| PREDICTED: uncharacterized protein LOC105175... 83 2e-16 >ref|XP_012848542.1| PREDICTED: pre-mRNA-splicing factor CWC22-like [Erythranthe guttata] gi|604315246|gb|EYU27952.1| hypothetical protein MIMGU_mgv1a023911mg [Erythranthe guttata] Length = 281 Score = 98.2 bits (243), Expect = 3e-22 Identities = 59/100 (59%), Positives = 69/100 (69%) Frame = -2 Query: 435 NRKIESPFIKSAPLLHDKVHRNGVVWKKPLTAFGGGDDPSEEVSEICSTLGDXXXXXXXX 256 +R+ ESPFIKS+PLL D RNG V KKP A+GGG+D SEEVSEICSTLG+ Sbjct: 75 HRRSESPFIKSSPLLSD-YSRNGAVCKKPFAAYGGGEDLSEEVSEICSTLGE-SEGVSVS 132 Query: 255 XXXXEKRENDVESREHHRQRSPARRKTTSFSGEVRRDKIV 136 EKR+N+ E RE RQRSPAR K FSGEV+R+K V Sbjct: 133 TTMTEKRDNNDELRE-LRQRSPARLKNRPFSGEVKREKTV 171 >ref|XP_011096444.1| PREDICTED: uncharacterized protein LOC105175639 [Sesamum indicum] Length = 276 Score = 82.8 bits (203), Expect = 2e-16 Identities = 57/107 (53%), Positives = 64/107 (59%), Gaps = 7/107 (6%) Frame = -2 Query: 435 NRKIESPFIKSAPLL-------HDKVHRNGVVWKKPLTAFGGGDDPSEEVSEICSTLGDX 277 NR+ ESPFIK+APLL HDK H NG KKP AF +D SEEVSEICST + Sbjct: 69 NRQHESPFIKAAPLLPDFSRNAHDKKHPNGGACKKPFMAFSN-EDLSEEVSEICSTHSES 127 Query: 276 XXXXXXXXXXXEKRENDVESREHHRQRSPARRKTTSFSGEVRRDKIV 136 KREND E RE RQRSPAR + S SGEV++DK V Sbjct: 128 VSISTTITE---KREND-ELREL-RQRSPARYRNRSISGEVKKDKTV 169