BLASTX nr result
ID: Rehmannia28_contig00037731
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00037731 (444 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851349.1| PREDICTED: uncharacterized protein LOC105971... 61 3e-08 ref|XP_011098696.1| PREDICTED: uncharacterized protein LOC105177... 60 6e-08 >ref|XP_012851349.1| PREDICTED: uncharacterized protein LOC105971042 [Erythranthe guttata] gi|604345662|gb|EYU44159.1| hypothetical protein MIMGU_mgv1a008886mg [Erythranthe guttata] Length = 359 Score = 60.8 bits (146), Expect = 3e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 2 EERQILLAEFYLRHNKNTISIAEEFSQRKLATPASKL 112 EE +ILLAEFYLRHNKNTI IA EFS+RKL +P SKL Sbjct: 323 EENKILLAEFYLRHNKNTIRIANEFSKRKLTSPTSKL 359 >ref|XP_011098696.1| PREDICTED: uncharacterized protein LOC105177297 [Sesamum indicum] gi|747101159|ref|XP_011098697.1| PREDICTED: uncharacterized protein LOC105177297 [Sesamum indicum] Length = 368 Score = 60.1 bits (144), Expect = 6e-08 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +2 Query: 2 EERQILLAEFYLRHNKNTISIAEEFSQRKLATPASKL 112 EERQILLAEFYLRHNKN++SIA EFS+RK+++ SKL Sbjct: 332 EERQILLAEFYLRHNKNSLSIANEFSKRKVSSSVSKL 368