BLASTX nr result
ID: Rehmannia28_contig00036606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036606 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX19935.1| coat protein [Nandina mosaic virus] 67 4e-10 gb|ALD19727.1| coat protein, partial [Plantago asiatica mosaic v... 65 7e-10 dbj|BAG12142.1| coat protein [Plantago asiatica mosaic virus] 65 1e-09 dbj|BAG12127.1| coat protein [Plantago asiatica mosaic virus] gi... 65 1e-09 emb|CEJ09728.1| coat protein [Plantago asiatica mosaic virus] 65 2e-09 emb|CEJ09726.1| coat protein [Plantago asiatica mosaic virus] 65 2e-09 emb|CEN56834.1| coat protein [Plantago asiatica mosaic virus] gi... 65 2e-09 gb|AIU41379.1| coat protein [Plantago asiatica mosaic virus] 65 2e-09 gb|AGW45385.1| coat protein [Plantago asiatica mosaic virus] 65 2e-09 dbj|BAG12157.1| coat protein [Plantago asiatica mosaic virus] 64 4e-09 ref|NP_620840.1| capsid protein [Plantago asiatica mosaic virus]... 63 9e-09 emb|CEQ38551.1| coat protein [Plantago asiatica mosaic virus] gi... 62 1e-08 gb|AAW30636.1| coat protein, partial [Tulip virus X] 60 6e-08 ref|NP_702992.1| coat protein [Tulip virus X] gi|23491558|dbj|BA... 60 1e-07 gb|ACE62921.1| coat protein [Tulip virus X] 59 2e-07 gb|AMN10087.1| coat protein [Plantago asiatica mosaic virus] 58 4e-07 >gb|AAX19935.1| coat protein [Nandina mosaic virus] Length = 207 Score = 66.6 bits (161), Expect = 4e-10 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG+SRTPTPDEVTANETARSLNLFEARA S + ST + Sbjct: 144 LEPLGGLSRTPTPDEVTANETARSLNLFEARANSSNLASTSTQF 187 >gb|ALD19727.1| coat protein, partial [Plantago asiatica mosaic virus] Length = 153 Score = 64.7 bits (156), Expect = 7e-10 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 90 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 133 >dbj|BAG12142.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEP+GG++RTPTPDEVTANETARSLNLFEARA S + ST + Sbjct: 144 LEPIGGLTRTPTPDEVTANETARSLNLFEARASSSNLASTSTQF 187 >dbj|BAG12127.1| coat protein [Plantago asiatica mosaic virus] gi|169219481|dbj|BAG12132.1| coat protein [Plantago asiatica mosaic virus] gi|169219487|dbj|BAG12137.1| coat protein [Plantago asiatica mosaic virus] gi|169219499|dbj|BAG12147.1| coat protein [Plantago asiatica mosaic virus] gi|169219505|dbj|BAG12152.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEP+GG++RTPTPDEVTANETARSLNLFEARA S + ST + Sbjct: 144 LEPIGGLTRTPTPDEVTANETARSLNLFEARASSSNLASTSTQF 187 >emb|CEJ09728.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 187 >emb|CEJ09726.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 187 >emb|CEN56834.1| coat protein [Plantago asiatica mosaic virus] gi|927028444|emb|CEQ38549.1| coat protein [Plantago asiatica mosaic virus] gi|927028446|emb|CEQ38550.1| coat protein [Plantago asiatica mosaic virus] gi|927440245|emb|CEJ09727.1| coat protein [Plantago asiatica mosaic virus] gi|987312892|gb|AMD78105.1| CP [Plantago asiatica mosaic virus] Length = 207 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 187 >gb|AIU41379.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 187 >gb|AGW45385.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 64.7 bits (156), Expect = 2e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANETARSLNLFEARASTSNLASTSTQF 187 >dbj|BAG12157.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEP+GG++RTPTPDEVTANETARSLNLFEARA + + ST + Sbjct: 144 LEPIGGLTRTPTPDEVTANETARSLNLFEARASNSNLASTSTQF 187 >ref|NP_620840.1| capsid protein [Plantago asiatica mosaic virus] gi|1168989|sp|Q07506.1|CAPSD_P1AMV RecName: Full=Coat protein; AltName: Full=Capsid protein; Short=CP gi|311649|emb|CAA79765.1| capsid protein [Plantago asiatica mosaic virus] Length = 207 Score = 62.8 bits (151), Expect = 9e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARA 96 LEP GG+SRTPTPDEVTANETARSLNLFEARA Sbjct: 144 LEPPGGLSRTPTPDEVTANETARSLNLFEARA 175 >emb|CEQ38551.1| coat protein [Plantago asiatica mosaic virus] gi|927028450|emb|CEQ38552.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 62.4 bits (150), Expect = 1e-08 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++RTPTPDEVTANE ARSLNLFEARA + + ST + Sbjct: 144 LEPLGGLTRTPTPDEVTANEMARSLNLFEARASTSNLASTSTQF 187 >gb|AAW30636.1| coat protein, partial [Tulip virus X] Length = 157 Score = 59.7 bits (143), Expect = 6e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++R PTPDE+TANETARSL LFE+RA S + ST + Sbjct: 94 LEPLGGLTREPTPDEITANETARSLGLFESRANSNNLATTSTQF 137 >ref|NP_702992.1| coat protein [Tulip virus X] gi|23491558|dbj|BAC16789.1| coat protein [Tulip virus X] Length = 207 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEPLGG++R PTPDE+TANETARSL LFE+RA S + ST + Sbjct: 144 LEPLGGLTREPTPDEITANETARSLGLFESRANSNNLATTSTQF 187 >gb|ACE62921.1| coat protein [Tulip virus X] Length = 207 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPS 102 LEPLGG++R PTPDE+TANETARSL LFE+RA S Sbjct: 144 LEPLGGLTREPTPDEITANETARSLGLFESRANS 177 >gb|AMN10087.1| coat protein [Plantago asiatica mosaic virus] Length = 207 Score = 58.2 bits (139), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 1 LEPLGGISRTPTPDEVTANETARSLNLFEARAPSLLSSVDSTLY 132 LEP GG++R PTPDE+TANETARSL+LFEARA S + ST + Sbjct: 144 LEPPGGLTRIPTPDEITANETARSLSLFEARANSSNLASTSTQF 187