BLASTX nr result
ID: Rehmannia28_contig00036460
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036460 (596 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012856634.1| PREDICTED: regulator of telomere elongation ... 70 1e-10 gb|EYU21548.1| hypothetical protein MIMGU_mgv1a017765mg [Erythra... 70 1e-10 ref|XP_011072337.1| PREDICTED: regulator of telomere elongation ... 65 4e-09 >ref|XP_012856634.1| PREDICTED: regulator of telomere elongation helicase 1 homolog [Erythranthe guttata] Length = 1016 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 DRRSLLHGFKEYVPAKYHSLYEHYLCTNSDAAGV 102 DRR LLHGFK+YVP KYHSLYEHYLC NSDAAG+ Sbjct: 983 DRRPLLHGFKDYVPTKYHSLYEHYLCNNSDAAGI 1016 >gb|EYU21548.1| hypothetical protein MIMGU_mgv1a017765mg [Erythranthe guttata] Length = 1031 Score = 69.7 bits (169), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 DRRSLLHGFKEYVPAKYHSLYEHYLCTNSDAAGV 102 DRR LLHGFK+YVP KYHSLYEHYLC NSDAAG+ Sbjct: 998 DRRPLLHGFKDYVPTKYHSLYEHYLCNNSDAAGI 1031 >ref|XP_011072337.1| PREDICTED: regulator of telomere elongation helicase 1 [Sesamum indicum] Length = 999 Score = 65.5 bits (158), Expect = 4e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 DRRSLLHGFKEYVPAKYHSLYEHYLCTNSDAAGV 102 DR SLLHGFKEYVPAKYHSLY+HY+ NSDAAGV Sbjct: 966 DRLSLLHGFKEYVPAKYHSLYQHYMRNNSDAAGV 999