BLASTX nr result
ID: Rehmannia28_contig00036314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036314 (351 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070095.1| PREDICTED: probable trehalose-phosphate phos... 58 2e-07 ref|XP_012852560.1| PREDICTED: probable trehalose-phosphate phos... 55 1e-06 ref|XP_011081207.1| PREDICTED: probable trehalose-phosphate phos... 55 2e-06 ref|XP_012845891.1| PREDICTED: probable trehalose-phosphate phos... 54 3e-06 >ref|XP_011070095.1| PREDICTED: probable trehalose-phosphate phosphatase F [Sesamum indicum] Length = 387 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 349 KESNAFFCLRDTSEVQDFLESLVRMAQEDGK 257 KESNAFF LRDTSEVQDFLESLVRMAQ+D K Sbjct: 355 KESNAFFSLRDTSEVQDFLESLVRMAQQDAK 385 >ref|XP_012852560.1| PREDICTED: probable trehalose-phosphate phosphatase F [Erythranthe guttata] gi|848906563|ref|XP_012852561.1| PREDICTED: probable trehalose-phosphate phosphatase F [Erythranthe guttata] Length = 393 Score = 55.5 bits (132), Expect = 1e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 349 KESNAFFCLRDTSEVQDFLESLVRMAQEDGKRDERGSEA 233 KESNAFF L+DTSEVQ+FLESLVR AQ+D K E G E+ Sbjct: 349 KESNAFFSLKDTSEVQEFLESLVRTAQKDAKIVEMGIES 387 >ref|XP_011081207.1| PREDICTED: probable trehalose-phosphate phosphatase F [Sesamum indicum] Length = 397 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -3 Query: 349 KESNAFFCLRDTSEVQDFLESLVRMAQEDGKRDERGSE 236 KESNAFF LRDTSEVQ FLESLVRMA++ G ER E Sbjct: 353 KESNAFFSLRDTSEVQGFLESLVRMARDGGTMKERRPE 390 >ref|XP_012845891.1| PREDICTED: probable trehalose-phosphate phosphatase F [Erythranthe guttata] gi|604318892|gb|EYU30313.1| hypothetical protein MIMGU_mgv1a007850mg [Erythranthe guttata] Length = 393 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 349 KESNAFFCLRDTSEVQDFLESLVRMAQEDGKRD 251 KESNA F LRDTSEVQDFLESLV+MAQED D Sbjct: 355 KESNASFSLRDTSEVQDFLESLVKMAQEDDDED 387