BLASTX nr result
ID: Rehmannia28_contig00036197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036197 (467 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] 69 7e-12 ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp.... 56 1e-07 gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Go... 57 5e-07 ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 54 1e-06 >gb|EPS74694.1| hypothetical protein M569_00069 [Genlisea aurea] Length = 190 Score = 69.3 bits (168), Expect = 7e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 148 RQNASLVRDEAKPIHTIGEGKTPHFIAPGERKFD 47 RQNASLVRDEAKP +TIGEGKTPHFIAPGERKFD Sbjct: 82 RQNASLVRDEAKPKYTIGEGKTPHFIAPGERKFD 115 >ref|XP_002868452.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314288|gb|EFH44711.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 96 Score = 56.2 bits (134), Expect = 1e-07 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 5/52 (9%) Frame = -1 Query: 191 LLAYVVVGLPTRMRPPECLLGSGRSQA----DTYDRRRKDPP-FHSAWGTQV 51 LLAYV+VGLPTR RPPECLL +A YDRRRKDP F+SAW + + Sbjct: 14 LLAYVMVGLPTRTRPPECLLFVVLDEAKPIHTIYDRRRKDPHLFNSAWASLI 65 >gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Gossypium raimondii] Length = 231 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +1 Query: 82 GSFLRLSYVSAWLRPEPRRHSGGRMR 159 GSFLRLSYVSAWLRPEPRRHSGGR+R Sbjct: 156 GSFLRLSYVSAWLRPEPRRHSGGRVR 181 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 (mitochondrion) [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 (mitochondrion) [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein (mitochondrion) [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 53.9 bits (128), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +3 Query: 81 GVFPSPIVCIGLASSRTKEAFWRTHACRKADDYIS 185 GVFPSPIVCIGLASSR+K + R ACRKAD YIS Sbjct: 74 GVFPSPIVCIGLASSRSK-LYLRARACRKADHYIS 107