BLASTX nr result
ID: Rehmannia28_contig00036166
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00036166 (449 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076925.1| PREDICTED: hippocampus abundant transcript-l... 63 7e-09 ref|XP_011076924.1| PREDICTED: hippocampus abundant transcript-l... 63 8e-09 >ref|XP_011076925.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Sesamum indicum] gi|747060950|ref|XP_011076926.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X2 [Sesamum indicum] Length = 375 Score = 62.8 bits (151), Expect = 7e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 1 IFASLSMVISLCFAWTLKLDDPSKKNLEDRPEDVETSLLS 120 IFAS+SMVISLC AWTLKLD P+ KN+ED ED+ET LLS Sbjct: 336 IFASISMVISLCCAWTLKLDVPTNKNVEDTREDIETPLLS 375 >ref|XP_011076924.1| PREDICTED: hippocampus abundant transcript-like protein 1 isoform X1 [Sesamum indicum] Length = 436 Score = 62.8 bits (151), Expect = 8e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +1 Query: 1 IFASLSMVISLCFAWTLKLDDPSKKNLEDRPEDVETSLLS 120 IFAS+SMVISLC AWTLKLD P+ KN+ED ED+ET LLS Sbjct: 397 IFASISMVISLCCAWTLKLDVPTNKNVEDTREDIETPLLS 436