BLASTX nr result
ID: Rehmannia28_contig00035925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00035925 (381 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015943924.1| PREDICTED: uncharacterized protein LOC107469... 58 2e-07 ref|XP_008662660.1| PREDICTED: collagen alpha-1(I) chain-like is... 57 3e-07 ref|XP_012453597.1| PREDICTED: uncharacterized protein LOC105775... 57 3e-07 gb|KYP68392.1| Retrovirus-related Pol polyprotein from transposo... 57 3e-07 ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787, p... 56 8e-07 ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427, p... 56 8e-07 ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040,... 56 9e-07 ref|XP_008671960.1| PREDICTED: uncharacterized protein LOC103649... 56 1e-06 gb|KYP70709.1| Retrovirus-related Pol polyprotein from transposo... 55 1e-06 ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460... 55 2e-06 gb|KYP61341.1| Retrovirus-related Pol polyprotein from transposo... 55 2e-06 gb|KYP46257.1| Retrovirus-related Pol polyprotein from transposo... 55 2e-06 ref|XP_012441837.1| PREDICTED: uncharacterized protein LOC105766... 55 3e-06 ref|XP_002446435.1| hypothetical protein SORBIDRAFT_06g016046, p... 55 3e-06 ref|XP_010027208.1| PREDICTED: uncharacterized protein LOC104417... 55 3e-06 ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177... 55 3e-06 ref|XP_002440449.1| hypothetical protein SORBIDRAFT_09g001135, p... 54 4e-06 ref|XP_002453623.1| hypothetical protein SORBIDRAFT_04g009135, p... 54 4e-06 ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255, p... 54 4e-06 ref|XP_008646585.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 54 4e-06 >ref|XP_015943924.1| PREDICTED: uncharacterized protein LOC107469046 [Arachis duranensis] Length = 454 Score = 58.2 bits (139), Expect = 2e-07 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 376 PSVFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFAT 257 P++F+GY KGYK LL KR+I+T V+FDETKFPFA+ Sbjct: 311 PAMFIGYGTSQKGYKCLLASKRVIVTRDVIFDETKFPFAS 350 >ref|XP_008662660.1| PREDICTED: collagen alpha-1(I) chain-like isoform X1 [Zea mays] Length = 406 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/46 (56%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSSAD 236 VFLGYSP HKGY+ L +R++I+ HVVFDE+ FP++T T S+D Sbjct: 103 VFLGYSPDHKGYRCFDLCSRRVLISRHVVFDESVFPYSTTTPPSSD 148 >ref|XP_012453597.1| PREDICTED: uncharacterized protein LOC105775649 [Gossypium raimondii] Length = 619 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = -3 Query: 379 QPSVFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSADSI 230 QP FLGYS HKGY+ LLPD RIII+ HV F+E++FP T S + Sbjct: 416 QPCTFLGYSSCHKGYQCLLPDGRIIISRHVEFNESRFPSPTSLSRSTREV 465 >gb|KYP68392.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 1085 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -3 Query: 379 QPSVFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSADSI 230 Q VFLGYS HKGYK L D+R+ I+ VVF+ETKFP+ + SS S+ Sbjct: 618 QECVFLGYSTSHKGYKCLAADERLYISNDVVFNETKFPYKELFSSSTASV 667 >ref|XP_002456118.1| hypothetical protein SORBIDRAFT_03g030787, partial [Sorghum bicolor] Length = 1567 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSSADS 233 VFLGYSP HKGY+ L +R++I+ HVVFDE+ FPF+T T ++ S Sbjct: 821 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIFPFSTTTTPASTS 867 >ref|XP_002460196.1| hypothetical protein SORBIDRAFT_02g024427, partial [Sorghum bicolor] Length = 1575 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSSADS 233 VFLGYSP HKGY+ L +R++I+ HVVFDE+ FPF+T T ++ S Sbjct: 824 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIFPFSTTTTPASTS 870 >ref|XP_002489074.1| hypothetical protein SORBIDRAFT_0139s002040, partial [Sorghum bicolor] gi|241947124|gb|EES20269.1| hypothetical protein SORBIDRAFT_0139s002040, partial [Sorghum bicolor] Length = 1822 Score = 56.2 bits (134), Expect = 9e-07 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSSADS 233 VFLGYSP HKGY+ L +R++I+ HVVFDE+ FPF+T T ++ S Sbjct: 1071 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDESIFPFSTTTTPASTS 1117 >ref|XP_008671960.1| PREDICTED: uncharacterized protein LOC103649473 [Zea mays] Length = 1477 Score = 55.8 bits (133), Expect = 1e-06 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSSA 239 VFLGYS +HKGY+ L + RIII+ HVVFDE+ FPFA SSA Sbjct: 890 VFLGYSSEHKGYRCLDISTNRIIISRHVVFDESSFPFAETPPSSA 934 >gb|KYP70709.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 257 Score = 55.1 bits (131), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFA 260 VFLGY P H+GYK L K+III+ HV+FDET+FPFA Sbjct: 220 VFLGYPPNHRGYKCFDLSSKKIIISRHVIFDETQFPFA 257 >ref|XP_015934891.1| PREDICTED: uncharacterized protein LOC107460974 [Arachis duranensis] Length = 873 Score = 55.1 bits (131), Expect = 2e-06 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = -3 Query: 370 VFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATI 254 +FLGYSP HKGYK L P ++ + HVVFDE++FP+ ++ Sbjct: 504 LFLGYSPYHKGYKCLCPSEKFYVARHVVFDESEFPYQSL 542 >gb|KYP61341.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1073 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = -3 Query: 379 QPSVFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSADS 233 Q VFLGYS HKGYK L D R+ I+ VVF+ETKFP+ + SS S Sbjct: 411 QECVFLGYSTSHKGYKCLAADGRLYISKDVVFNETKFPYKDLFSSSKAS 459 >gb|KYP46257.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1408 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = -3 Query: 379 QPSVFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSADS 233 Q VFLGYS HKGYK L D R+ I+ VVF+ETKFP+ + SS S Sbjct: 746 QECVFLGYSTSHKGYKCLAADGRLYISKDVVFNETKFPYKDLFSSSKAS 794 >ref|XP_012441837.1| PREDICTED: uncharacterized protein LOC105766820 [Gossypium raimondii] Length = 597 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/47 (53%), Positives = 31/47 (65%) Frame = -3 Query: 370 VFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSADSI 230 +FLGYSP H GYK L + R+ I HVVFDE FPFA+ S+ S+ Sbjct: 443 IFLGYSPTHNGYKYLDANNRLFIFRHVVFDEWWFPFASTASSTGGSL 489 >ref|XP_002446435.1| hypothetical protein SORBIDRAFT_06g016046, partial [Sorghum bicolor] Length = 856 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/38 (65%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFA 260 VF+GYSP HKGY+ L L R+II+ HVVFDET FPF+ Sbjct: 95 VFIGYSPDHKGYRCLDLTTNRVIISRHVVFDETTFPFS 132 >ref|XP_010027208.1| PREDICTED: uncharacterized protein LOC104417672 [Eucalyptus grandis] Length = 1047 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/46 (60%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVLLP-DKRIIITMHVVFDETKFPFATITQSSAD 236 +FLGYS QHKGY L+P D RI I+ HVVFDET FPF S D Sbjct: 344 IFLGYSEQHKGYHCLVPTDGRIYISRHVVFDETFFPFTKKLTSDYD 389 >ref|XP_015386863.1| PREDICTED: uncharacterized protein LOC107177515 [Citrus sinensis] Length = 1143 Score = 54.7 bits (130), Expect = 3e-06 Identities = 24/44 (54%), Positives = 31/44 (70%) Frame = -3 Query: 370 VFLGYSPQHKGYKVLLPDKRIIITMHVVFDETKFPFATITQSSA 239 VFLGYSP HKGYK L P R I HV+FDE+ FP++++ S+ Sbjct: 788 VFLGYSPLHKGYKCLHPSGRTYIASHVLFDESSFPYSSLFHVSS 831 >ref|XP_002440449.1| hypothetical protein SORBIDRAFT_09g001135, partial [Sorghum bicolor] Length = 488 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATIT 251 VFLGYSP HKGY+ L +R++I+ HVVFDE FPF+T T Sbjct: 136 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDEFVFPFSTTT 176 >ref|XP_002453623.1| hypothetical protein SORBIDRAFT_04g009135, partial [Sorghum bicolor] Length = 801 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATIT 251 VFLGYSP HKGY+ L +R++I+ HVVFDE FPF+T T Sbjct: 136 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDEFVFPFSTTT 176 >ref|XP_002444329.1| hypothetical protein SORBIDRAFT_07g020255, partial [Sorghum bicolor] Length = 987 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/41 (60%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATIT 251 VFLGYSP HKGY+ L +R++I+ HVVFDE FPF+T T Sbjct: 250 VFLGYSPDHKGYRCYDLTSRRVLISRHVVFDEFVFPFSTTT 290 >ref|XP_008646585.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103628087 [Zea mays] Length = 1134 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/44 (56%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -3 Query: 370 VFLGYSPQHKGYKVL-LPDKRIIITMHVVFDETKFPFATITQSS 242 VFLGYSP HKGY+ L L R++I+ HVVFDE+ FPF++ +S Sbjct: 596 VFLGYSPDHKGYRCLDLASHRVLISRHVVFDESDFPFSSAPTAS 639