BLASTX nr result
ID: Rehmannia28_contig00035877
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00035877 (344 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830309.1| PREDICTED: uncharacterized protein LOC105951... 67 4e-11 ref|XP_012830308.1| PREDICTED: uncharacterized protein LOC105951... 67 5e-11 ref|XP_011085974.1| PREDICTED: uncharacterized protein LOC105167... 64 6e-10 >ref|XP_012830309.1| PREDICTED: uncharacterized protein LOC105951425 isoform X2 [Erythranthe guttata] gi|604344570|gb|EYU43324.1| hypothetical protein MIMGU_mgv1a012940mg [Erythranthe guttata] Length = 235 Score = 66.6 bits (161), Expect = 4e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDYSAGIPSLAGGFEFSNKSVKTGIFGADKLQIRSLV 112 PDYSAGIPS+ GGFEFSNK+VKTG FGADKLQIRSLV Sbjct: 131 PDYSAGIPSM-GGFEFSNKTVKTGFFGADKLQIRSLV 166 >ref|XP_012830308.1| PREDICTED: uncharacterized protein LOC105951425 isoform X1 [Erythranthe guttata] Length = 247 Score = 66.6 bits (161), Expect = 5e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 2 PDYSAGIPSLAGGFEFSNKSVKTGIFGADKLQIRSLV 112 PDYSAGIPS+ GGFEFSNK+VKTG FGADKLQIRSLV Sbjct: 131 PDYSAGIPSM-GGFEFSNKTVKTGFFGADKLQIRSLV 166 >ref|XP_011085974.1| PREDICTED: uncharacterized protein LOC105167842 [Sesamum indicum] Length = 237 Score = 63.5 bits (153), Expect = 6e-10 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +2 Query: 2 PDYSAGIPSLAGGFEFSNKSVKTGIFGADKLQIRSLV 112 PDYSAGIPSL GGFEFSNKSVKTG+ ADKLQIRSLV Sbjct: 133 PDYSAGIPSL-GGFEFSNKSVKTGLLCADKLQIRSLV 168