BLASTX nr result
ID: Rehmannia28_contig00035659
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00035659 (314 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098823.1| PREDICTED: chaperone protein dnaJ 1, mitocho... 53 6e-06 >ref|XP_011098823.1| PREDICTED: chaperone protein dnaJ 1, mitochondrial isoform X1 [Sesamum indicum] Length = 471 Score = 52.8 bits (125), Expect = 6e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -3 Query: 312 WQYWVKRSTEPKFILEFSILMLIFLFLGKFL 220 W+YWVK + PK ILEFSIL+LIFLFLGK L Sbjct: 440 WEYWVKHAPAPKVILEFSILILIFLFLGKIL 470