BLASTX nr result
ID: Rehmannia28_contig00035130
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00035130 (657 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096752.1| PREDICTED: delta(24)-sterol reductase [Sesam... 59 9e-07 ref|XP_012827495.1| PREDICTED: delta(24)-sterol reductase [Eryth... 58 2e-06 ref|XP_008221029.1| PREDICTED: delta(24)-sterol reductase [Prunu... 57 3e-06 ref|XP_007222469.1| hypothetical protein PRUPE_ppa003520mg [Prun... 57 3e-06 ref|XP_009351705.1| PREDICTED: delta(24)-sterol reductase [Pyrus... 56 7e-06 ref|XP_008340460.1| PREDICTED: delta(24)-sterol reductase-like [... 56 7e-06 ref|XP_008389095.1| PREDICTED: delta(24)-sterol reductase [Malus... 56 7e-06 dbj|BAS68578.1| delta(24)-sterol reductase [Ajuga reptans] 56 1e-05 >ref|XP_011096752.1| PREDICTED: delta(24)-sterol reductase [Sesamum indicum] gi|747097564|ref|XP_011096753.1| PREDICTED: delta(24)-sterol reductase [Sesamum indicum] gi|747097566|ref|XP_011096754.1| PREDICTED: delta(24)-sterol reductase [Sesamum indicum] Length = 563 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDA 91 VYYKSKKGRKTEKEVQEAEQA+LETPD +A Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPDAEA 562 >ref|XP_012827495.1| PREDICTED: delta(24)-sterol reductase [Erythranthe guttata] gi|848927493|ref|XP_012827496.1| PREDICTED: delta(24)-sterol reductase [Erythranthe guttata] gi|604299130|gb|EYU19065.1| hypothetical protein MIMGU_mgv1a003798mg [Erythranthe guttata] gi|604299131|gb|EYU19066.1| hypothetical protein MIMGU_mgv1a003798mg [Erythranthe guttata] Length = 563 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVD 88 VYYKSKKGRKTEKEVQEAEQA+L+TPDV+ Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILDTPDVE 561 >ref|XP_008221029.1| PREDICTED: delta(24)-sterol reductase [Prunus mume] gi|645228510|ref|XP_008221030.1| PREDICTED: delta(24)-sterol reductase [Prunus mume] Length = 568 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDAD 94 VYYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPSAEVD 563 >ref|XP_007222469.1| hypothetical protein PRUPE_ppa003520mg [Prunus persica] gi|462419405|gb|EMJ23668.1| hypothetical protein PRUPE_ppa003520mg [Prunus persica] Length = 568 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDAD 94 VYYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPSAEVD 563 >ref|XP_009351705.1| PREDICTED: delta(24)-sterol reductase [Pyrus x bretschneideri] Length = 568 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDAD 94 VYYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPIAEVD 563 >ref|XP_008340460.1| PREDICTED: delta(24)-sterol reductase-like [Malus domestica] Length = 568 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDAD 94 VYYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPIAEVD 563 >ref|XP_008389095.1| PREDICTED: delta(24)-sterol reductase [Malus domestica] Length = 568 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVDAD 94 VYYKSKKGRKTEKEVQEAEQA+LETP + D Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILETPIAEVD 563 >dbj|BAS68578.1| delta(24)-sterol reductase [Ajuga reptans] Length = 563 Score = 55.8 bits (133), Expect = 1e-05 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +2 Query: 2 VYYKSKKGRKTEKEVQEAEQAVLETPDVD 88 VYYKSKKGRKTEKEVQEAEQA+LE+PD + Sbjct: 533 VYYKSKKGRKTEKEVQEAEQAILESPDAE 561