BLASTX nr result
ID: Rehmannia28_contig00034996
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034996 (317 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849718.1| PREDICTED: cysteine-rich receptor-like prote... 61 1e-08 >ref|XP_012849718.1| PREDICTED: cysteine-rich receptor-like protein kinase 42 [Erythranthe guttata] gi|604346311|gb|EYU44774.1| hypothetical protein MIMGU_mgv1a002463mg [Erythranthe guttata] Length = 671 Score = 60.8 bits (146), Expect = 1e-08 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 4/48 (8%) Frame = +1 Query: 184 MHLSTSNFPNPTWI--IIFTMTHIL--PLSLSDPRISEAGLVCGQTRP 315 MHLS+SN NP WI IF +T ++ PLSLSDPRISEAGL CGQ+RP Sbjct: 1 MHLSSSNLLNPPWITPFIFFITALILFPLSLSDPRISEAGLFCGQSRP 48