BLASTX nr result
ID: Rehmannia28_contig00034955
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034955 (442 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094938.1| PREDICTED: class I heat shock protein [Sesam... 73 9e-14 ref|XP_009623166.1| PREDICTED: 17.6 kDa class I heat shock prote... 60 9e-09 ref|XP_009783071.1| PREDICTED: class I heat shock protein-like [... 57 2e-07 >ref|XP_011094938.1| PREDICTED: class I heat shock protein [Sesamum indicum] Length = 135 Score = 72.8 bits (177), Expect = 9e-14 Identities = 40/58 (68%), Positives = 41/58 (70%) Frame = -2 Query: 174 MSLIPHLLREIYQAPFNSTTETFTPAVDWKETPEAHVLKADLPGLXXXXXXXXXEDGG 1 MSLIP LLREIYQ PFNST+ P VDWKETPE HVLKADLPGL EDGG Sbjct: 1 MSLIPQLLREIYQ-PFNSTSAALAP-VDWKETPEVHVLKADLPGLKKEEVKVEVEDGG 56 >ref|XP_009623166.1| PREDICTED: 17.6 kDa class I heat shock protein-like [Nicotiana tomentosiformis] Length = 131 Score = 59.7 bits (143), Expect = 9e-09 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -2 Query: 174 MSLIPHLLREIYQAPFNSTTETFTPAVDWKETPEAHVLKADLPGL 40 M+LIP LL +I+Q ST ET P VDWKET EAHV KADLPGL Sbjct: 1 MALIPQLLDDIFQ--IGSTNETCNPRVDWKETQEAHVFKADLPGL 43 >ref|XP_009783071.1| PREDICTED: class I heat shock protein-like [Nicotiana sylvestris] Length = 141 Score = 56.6 bits (135), Expect = 2e-07 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 6/51 (11%) Frame = -2 Query: 174 MSLIPHLLREIYQAPFN---STTETF---TPAVDWKETPEAHVLKADLPGL 40 M+LIP LL +I+Q PFN ST ET P VDWKET EAHV KADLPGL Sbjct: 1 MALIPQLLDDIFQ-PFNLIGSTNETSKFSNPRVDWKETQEAHVFKADLPGL 50