BLASTX nr result
ID: Rehmannia28_contig00034890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034890 (406 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008231825.1| PREDICTED: putative ribonuclease H protein A... 55 9e-07 >ref|XP_008231825.1| PREDICTED: putative ribonuclease H protein At1g65750 [Prunus mume] Length = 183 Score = 55.1 bits (131), Expect = 9e-07 Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -3 Query: 401 VPWVLKGXXXXXXXXXXRIHFRASHVFREANRAADALAKQ-AYVVGNTWWDVAPNFL 234 VPW+L+G I F+ SH+FRE N AADALA A G WWD AP+F+ Sbjct: 122 VPWLLRGDWQNCLHRLQHISFKISHIFREDNHAADALANHGALGSGLIWWDTAPSFI 178