BLASTX nr result
ID: Rehmannia28_contig00034764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034764 (637 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004490385.1| PREDICTED: uncharacterized protein At1g04910... 61 1e-07 ref|XP_004490384.1| PREDICTED: uncharacterized protein At1g04910... 61 1e-07 ref|XP_011074208.1| PREDICTED: uncharacterized protein At1g04910... 61 1e-07 ref|XP_010664349.1| PREDICTED: uncharacterized protein At1g04910... 58 2e-06 emb|CBI19199.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_010098633.1| hypothetical protein L484_012746 [Morus nota... 57 5e-06 ref|XP_003615165.2| auxin-independent growth promoter-like prote... 56 8e-06 >ref|XP_004490385.1| PREDICTED: uncharacterized protein At1g04910 isoform X2 [Cicer arietinum] Length = 451 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FY NPLP CLCQ EPPH NIS I+K Sbjct: 419 DRFRSEEAFYANPLPDCLCQTEPPHQNISHIVK 451 >ref|XP_004490384.1| PREDICTED: uncharacterized protein At1g04910 isoform X1 [Cicer arietinum] Length = 524 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FY NPLP CLCQ EPPH NIS I+K Sbjct: 492 DRFRSEEAFYANPLPDCLCQTEPPHQNISHIVK 524 >ref|XP_011074208.1| PREDICTED: uncharacterized protein At1g04910 [Sesamum indicum] Length = 537 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 635 TDRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 T+RFRSEE FYVNPLP CLCQKE PH N SLIIK Sbjct: 504 TERFRSEEPFYVNPLPDCLCQKESPHMNGSLIIK 537 >ref|XP_010664349.1| PREDICTED: uncharacterized protein At1g04910 [Vitis vinifera] Length = 535 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FYVNP+P CLC KEPP N S+II+ Sbjct: 503 DRFRSEEAFYVNPIPDCLCHKEPPDMNTSIIIR 535 >emb|CBI19199.3| unnamed protein product [Vitis vinifera] Length = 536 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FYVNP+P CLC KEPP N S+II+ Sbjct: 504 DRFRSEEAFYVNPIPDCLCHKEPPDMNTSIIIR 536 >ref|XP_010098633.1| hypothetical protein L484_012746 [Morus notabilis] gi|587886581|gb|EXB75372.1| hypothetical protein L484_012746 [Morus notabilis] Length = 518 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FYVNPLP CLC+KE P +N+SL+++ Sbjct: 486 DRFRSEEAFYVNPLPDCLCRKELPSANVSLVMR 518 >ref|XP_003615165.2| auxin-independent growth promoter-like protein [Medicago truncatula] gi|657385150|gb|AES98123.2| auxin-independent growth promoter-like protein [Medicago truncatula] Length = 525 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 632 DRFRSEESFYVNPLPVCLCQKEPPHSNISLIIK 534 DRFRSEE+FY NPLP CLC+ EPP NIS IIK Sbjct: 493 DRFRSEETFYANPLPDCLCRTEPPSRNISDIIK 525