BLASTX nr result
ID: Rehmannia28_contig00034748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034748 (325 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20654.1| unnamed protein product [Coffea canephora] 63 2e-09 ref|XP_011020349.1| PREDICTED: calcium-dependent protein kinase ... 61 8e-09 ref|XP_002308958.1| calcium-dependent protein kinase [Populus tr... 61 8e-09 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 61 8e-09 ref|XP_011090028.1| PREDICTED: calcium-dependent protein kinase ... 61 8e-09 ref|XP_015875906.1| PREDICTED: calcium-dependent protein kinase ... 61 8e-09 ref|XP_009366097.1| PREDICTED: calcium-dependent protein kinase ... 60 1e-08 ref|XP_008344697.1| PREDICTED: calcium-dependent protein kinase ... 60 1e-08 ref|XP_010102356.1| Calcium-dependent protein kinase 8 [Morus no... 59 4e-08 ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase ... 59 5e-08 gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] 59 7e-08 ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prun... 58 9e-08 ref|XP_011075229.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 gb|KNA14653.1| hypothetical protein SOVF_105100 isoform A [Spina... 58 9e-08 ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 ref|XP_008804559.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 ref|XP_008227350.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase ... 58 9e-08 ref|XP_010931028.1| PREDICTED: calcium-dependent protein kinase ... 58 1e-07 >emb|CDP20654.1| unnamed protein product [Coffea canephora] Length = 532 Score = 62.8 bits (151), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMRDGSLQLANEGR Sbjct: 502 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 532 >ref|XP_011020349.1| PREDICTED: calcium-dependent protein kinase 32-like [Populus euphratica] Length = 528 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMRDGSL+LANEGR Sbjct: 498 KASRQYSRERFNSLSLKLMRDGSLKLANEGR 528 >ref|XP_002308958.1| calcium-dependent protein kinase [Populus trichocarpa] gi|222854934|gb|EEE92481.1| calcium-dependent protein kinase [Populus trichocarpa] Length = 528 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMRDGSL+LANEGR Sbjct: 498 KASRQYSRERFNSLSLKLMRDGSLKLANEGR 528 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMRDGSLQL NEGR Sbjct: 502 KASRQYSRERFNSLSLKLMRDGSLQLTNEGR 532 >ref|XP_011090028.1| PREDICTED: calcium-dependent protein kinase 8-like [Sesamum indicum] Length = 533 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMRDGSL+LANEGR Sbjct: 503 KASRQYSRERFNSLSLKLMRDGSLKLANEGR 533 >ref|XP_015875906.1| PREDICTED: calcium-dependent protein kinase 8 [Ziziphus jujuba] gi|1009118527|ref|XP_015875907.1| PREDICTED: calcium-dependent protein kinase 8 [Ziziphus jujuba] gi|1009118529|ref|XP_015875908.1| PREDICTED: calcium-dependent protein kinase 8 [Ziziphus jujuba] Length = 534 Score = 61.2 bits (147), Expect = 8e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLMR+GSLQLANEGR Sbjct: 503 KASRQYSRERFNSLSLKLMREGSLQLANEGR 533 >ref|XP_009366097.1| PREDICTED: calcium-dependent protein kinase 8-like [Pyrus x bretschneideri] Length = 533 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNS+SLKLMR+GSLQLANEGR Sbjct: 503 KASRQYSRERFNSISLKLMREGSLQLANEGR 533 >ref|XP_008344697.1| PREDICTED: calcium-dependent protein kinase 8-like [Malus domestica] Length = 533 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNS+SLKLMR+GSLQLANEGR Sbjct: 503 KASRQYSRERFNSISLKLMREGSLQLANEGR 533 >ref|XP_010102356.1| Calcium-dependent protein kinase 8 [Morus notabilis] gi|587905126|gb|EXB93317.1| Calcium-dependent protein kinase 8 [Morus notabilis] Length = 579 Score = 59.3 bits (142), Expect = 4e-08 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEG 235 KASRQYSRERFNSLSLKLMRDGSLQL NEG Sbjct: 502 KASRQYSRERFNSLSLKLMRDGSLQLTNEG 531 >ref|XP_004291780.1| PREDICTED: calcium-dependent protein kinase 8-like isoform X2 [Fragaria vesca subsp. vesca] Length = 532 Score = 58.9 bits (141), Expect = 5e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNS+SLKLMR+GSLQL NEGR Sbjct: 502 KASRQYSRERFNSISLKLMREGSLQLTNEGR 532 >gb|AEL88279.1| calcium-dependent protein kinase [Dimocarpus longan] Length = 534 Score = 58.5 bits (140), Expect = 7e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFN+LSLKLMRDGSLQ+ NEGR Sbjct: 504 KASRQYSRERFNNLSLKLMRDGSLQMNNEGR 534 >ref|XP_007211733.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] gi|462407598|gb|EMJ12932.1| hypothetical protein PRUPE_ppa006164mg [Prunus persica] Length = 425 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNS+SLKLMR+GSLQLA EGR Sbjct: 395 KASRQYSRERFNSISLKLMREGSLQLATEGR 425 >ref|XP_011075229.1| PREDICTED: calcium-dependent protein kinase 32 isoform X2 [Sesamum indicum] Length = 454 Score = 58.2 bits (139), Expect = 9e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRER+NSLSLKLM+DGSLQ+ NEGR Sbjct: 424 KASRQYSRERYNSLSLKLMKDGSLQMGNEGR 454 >gb|KNA14653.1| hypothetical protein SOVF_105100 isoform A [Spinacia oleracea] Length = 488 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFN+LSLKLM+DGSLQ ANEGR Sbjct: 458 KASRQYSRERFNNLSLKLMKDGSLQSANEGR 488 >ref|XP_010667055.1| PREDICTED: calcium-dependent protein kinase 8-like [Beta vulgaris subsp. vulgaris] gi|870842141|gb|KMS95633.1| hypothetical protein BVRB_006440 [Beta vulgaris subsp. vulgaris] Length = 529 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFN+LSLKLM+DGSLQ ANEGR Sbjct: 499 KASRQYSRERFNNLSLKLMKDGSLQSANEGR 529 >ref|XP_011075228.1| PREDICTED: calcium-dependent protein kinase 32 isoform X1 [Sesamum indicum] Length = 530 Score = 58.2 bits (139), Expect = 9e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRER+NSLSLKLM+DGSLQ+ NEGR Sbjct: 500 KASRQYSRERYNSLSLKLMKDGSLQMGNEGR 530 >ref|XP_008804559.1| PREDICTED: calcium-dependent protein kinase 32-like [Phoenix dactylifera] Length = 531 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLM+DGSLQL +EGR Sbjct: 501 KASRQYSRERFNSLSLKLMKDGSLQLTSEGR 531 >ref|XP_008227350.1| PREDICTED: calcium-dependent protein kinase 8-like [Prunus mume] Length = 533 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNS+SLKLMR+GSLQLA EGR Sbjct: 503 KASRQYSRERFNSISLKLMREGSLQLATEGR 533 >ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase 8-like [Erythranthe guttata] gi|604320415|gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Erythranthe guttata] Length = 533 Score = 58.2 bits (139), Expect = 9e-08 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLM++GSL LANEGR Sbjct: 503 KASRQYSRERFNSLSLKLMKEGSLHLANEGR 533 >ref|XP_010931028.1| PREDICTED: calcium-dependent protein kinase 32 [Elaeis guineensis] Length = 532 Score = 57.8 bits (138), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 324 KASRQYSRERFNSLSLKLMRDGSLQLANEGR 232 KASRQYSRERFNSLSLKLM+DG LQLA+EGR Sbjct: 502 KASRQYSRERFNSLSLKLMKDGCLQLASEGR 532