BLASTX nr result
ID: Rehmannia28_contig00034707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034707 (413 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46668.1| hypothetical protein MIMGU_mgv1a016256mg [Erythra... 57 1e-07 ref|XP_012832956.1| PREDICTED: uncharacterized protein LOC105953... 57 5e-07 >gb|EYU46668.1| hypothetical protein MIMGU_mgv1a016256mg [Erythranthe guttata] Length = 128 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 412 DNASKLERVGENSLQKGHYRCRRKKQDLRMVDTPS 308 DNASKLERVGENSLQK H+R RRKK ++RM+D+ S Sbjct: 94 DNASKLERVGENSLQKAHHRGRRKKHEMRMMDSQS 128 >ref|XP_012832956.1| PREDICTED: uncharacterized protein LOC105953819 [Erythranthe guttata] Length = 247 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 412 DNASKLERVGENSLQKGHYRCRRKKQDLRMVDTPS 308 DNASKLERVGENSLQK H+R RRKK ++RM+D+ S Sbjct: 213 DNASKLERVGENSLQKAHHRGRRKKHEMRMMDSQS 247