BLASTX nr result
ID: Rehmannia28_contig00034604
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034604 (360 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073730.1| PREDICTED: pathogenesis-related protein STH-... 58 3e-08 ref|XP_012843198.1| PREDICTED: pathogenesis-related protein STH-... 56 1e-07 gb|EYU32597.1| hypothetical protein MIMGU_mgv1a015377mg [Erythra... 56 2e-07 ref|XP_012843117.1| PREDICTED: pathogenesis-related protein STH-... 56 2e-07 >ref|XP_011073730.1| PREDICTED: pathogenesis-related protein STH-2-like [Sesamum indicum] Length = 160 Score = 58.2 bits (139), Expect = 3e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 360 IELNDDEIKAGKEQAMVLYKACEEYLHAHPDVCA 259 +ELND+EIKAGKEQA VLYKA EEYL A+P VCA Sbjct: 127 VELNDEEIKAGKEQAAVLYKAAEEYLAANPHVCA 160 >ref|XP_012843198.1| PREDICTED: pathogenesis-related protein STH-2-like [Erythranthe guttata] gi|604322210|gb|EYU32596.1| hypothetical protein MIMGU_mgv1a015386mg [Erythranthe guttata] Length = 159 Score = 56.2 bits (134), Expect = 1e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 354 LNDDEIKAGKEQAMVLYKACEEYLHAHPDVCA 259 +NDDEIKAGKEQA+ LYKACE+YL A+P VCA Sbjct: 128 INDDEIKAGKEQALGLYKACEDYLIANPHVCA 159 >gb|EYU32597.1| hypothetical protein MIMGU_mgv1a015377mg [Erythranthe guttata] Length = 159 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 354 LNDDEIKAGKEQAMVLYKACEEYLHAHPDVCA 259 +ND+EIKAGKEQA+ LYKACEEYL A+P VCA Sbjct: 128 INDEEIKAGKEQALGLYKACEEYLIANPHVCA 159 >ref|XP_012843117.1| PREDICTED: pathogenesis-related protein STH-2-like [Erythranthe guttata] Length = 168 Score = 55.8 bits (133), Expect = 2e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 354 LNDDEIKAGKEQAMVLYKACEEYLHAHPDVCA 259 +ND+EIKAGKEQA+ LYKACEEYL A+P VCA Sbjct: 137 INDEEIKAGKEQALGLYKACEEYLIANPHVCA 168