BLASTX nr result
ID: Rehmannia28_contig00034584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034584 (329 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091437.1| PREDICTED: probable dimethyladenosine transf... 69 1e-11 ref|XP_012843652.1| PREDICTED: probable dimethyladenosine transf... 63 1e-09 gb|AAF78414.1|AC009273_20 Identical to dimethyladenosine transfe... 53 5e-07 gb|EPS74235.1| dimethyladenosine transferase, partial [Genlisea ... 53 5e-06 ref|XP_002270274.1| PREDICTED: probable dimethyladenosine transf... 53 5e-06 ref|XP_008438106.1| PREDICTED: probable dimethyladenosine transf... 53 5e-06 ref|NP_171690.1| dimethyladenosine transferase [Arabidopsis thal... 53 7e-06 >ref|XP_011091437.1| PREDICTED: probable dimethyladenosine transferase isoform X1 [Sesamum indicum] Length = 350 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 328 PDIEAALCAANLPPTSRPEELTLQDFVRLHNLLVKT 221 PDIEAALCAA LPPTSRPEELTL+DFV+LHNL+ KT Sbjct: 315 PDIEAALCAAGLPPTSRPEELTLEDFVKLHNLIAKT 350 >ref|XP_012843652.1| PREDICTED: probable dimethyladenosine transferase [Erythranthe guttata] gi|604321473|gb|EYU32049.1| hypothetical protein MIMGU_mgv1a009260mg [Erythranthe guttata] Length = 348 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -2 Query: 325 DIEAALCAANLPPTSRPEELTLQDFVRLHNLLVK 224 DIE+ALCAA+L PTSRPEELTL+DFVRLHNLLVK Sbjct: 314 DIESALCAADLLPTSRPEELTLEDFVRLHNLLVK 347 >gb|AAF78414.1|AC009273_20 Identical to dimethyladenosine transferase from Arabidopsis thaliana gb|AF051326. It contains ribosomal RNA adenine dimethylases PF|00398. This gene is cut off, partial [Arabidopsis thaliana] Length = 87 Score = 52.8 bits (125), Expect = 5e-07 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 328 PDIEAALCAANLPPTSRPEELTLQDFVRLHNLLVK 224 PDIE AL A LP TSRPEELTL DFV+LHN++ + Sbjct: 52 PDIEKALGVAGLPATSRPEELTLDDFVKLHNVIAR 86 >gb|EPS74235.1| dimethyladenosine transferase, partial [Genlisea aurea] Length = 300 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 328 PDIEAALCAANLPPTSRPEELTLQDFVRLHNLL 230 PDIEAAL A L TSRPEEL+LQDFV+LHNLL Sbjct: 268 PDIEAALRTAGLAATSRPEELSLQDFVKLHNLL 300 >ref|XP_002270274.1| PREDICTED: probable dimethyladenosine transferase [Vitis vinifera] gi|296089082|emb|CBI38785.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -2 Query: 325 DIEAALCAANLPPTSRPEELTLQDFVRLHNLLVKT 221 +IE AL LP TSRPEELTL DFVRLHNL+VKT Sbjct: 301 EIEEALRNVGLPATSRPEELTLDDFVRLHNLIVKT 335 >ref|XP_008438106.1| PREDICTED: probable dimethyladenosine transferase [Cucumis melo] Length = 347 Score = 53.1 bits (126), Expect = 5e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 325 DIEAALCAANLPPTSRPEELTLQDFVRLHNLLVK 224 +IE AL ++LPPTSRPEEL+L DFVRLHNL+VK Sbjct: 313 EIEKALEDSSLPPTSRPEELSLDDFVRLHNLIVK 346 >ref|NP_171690.1| dimethyladenosine transferase [Arabidopsis thaliana] gi|75099292|sp|O65090.1|DIM1C_ARATH RecName: Full=Ribosomal RNA small subunit methyltransferase, chloroplastic; AltName: Full=Dimethyladenosine transferase 1C; AltName: Full=Protein PALEFACE 1; Flags: Precursor gi|3005590|gb|AAC09322.1| dimethyladenosine transferase [Arabidopsis thaliana] gi|26449914|dbj|BAC42078.1| putative dimethyladenosine transferase [Arabidopsis thaliana] gi|28827572|gb|AAO50630.1| putative dimethyladenosine transferase [Arabidopsis thaliana] gi|332189223|gb|AEE27344.1| ribosomal RNA adenine dimethylase family protein [Arabidopsis thaliana] Length = 343 Score = 52.8 bits (125), Expect = 7e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 328 PDIEAALCAANLPPTSRPEELTLQDFVRLHNLLVK 224 PDIE AL A LP TSRPEELTL DFV+LHN++ + Sbjct: 308 PDIEKALGVAGLPATSRPEELTLDDFVKLHNVIAR 342