BLASTX nr result
ID: Rehmannia28_contig00034319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034319 (2421 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] 94 1e-19 gb|EEF25756.1| conserved hypothetical protein [Ricinus communis]... 69 4e-11 gb|AIE42561.1| hypothetical protein RadishMT_p030 (mitochondrion... 64 5e-09 ref|YP_004927580.1| orf106a (mitochondrion) [Brassica carinata] ... 64 6e-09 ref|YP_004927474.1| orf106a (mitochondrion) [Brassica oleracea] ... 64 6e-09 gb|AGC81682.1| hypothetical protein DCGMS_00220 (mitochondrion) ... 64 7e-09 ref|YP_717108.1| hypothetical protein BrnapMp009 [Brassica napus... 62 3e-08 >gb|AGC78850.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 91 Score = 94.0 bits (232), Expect = 1e-19 Identities = 44/45 (97%), Positives = 44/45 (97%) Frame = +3 Query: 6 ILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRDRYSFPAAFS 140 ILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRD YSFPAAFS Sbjct: 47 ILGAEVYEEWLFGPFRPVVRTSSFHVEDTGSIPVRDGYSFPAAFS 91 >gb|EEF25756.1| conserved hypothetical protein [Ricinus communis] gi|223522900|gb|EEF26887.1| conserved hypothetical protein [Ricinus communis] Length = 59 Score = 68.6 bits (166), Expect = 4e-11 Identities = 37/54 (68%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 329 KERMHGDSVCR-RFEMKGHRWLRKNSRKSITERNGDLVLLAGREEASGPPFPAR 171 ++R H S+ + MK H LRKNSRKSITER+GDLVLLAGREEASGPPF AR Sbjct: 6 RKRTHAWSLSEMKKSMKRHLRLRKNSRKSITERSGDLVLLAGREEASGPPFSAR 59 >gb|AIE42561.1| hypothetical protein RadishMT_p030 (mitochondrion) [Raphanus sativus] Length = 94 Score = 63.9 bits (154), Expect = 5e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 38 FWSLSSSG*DIVFSCRRHGFDSRKG*VLIPGRFQLVFI 151 F SLSSSG DIVFSCRRHGFDSR+G +LI GRFQLVFI Sbjct: 5 FLSLSSSGSDIVFSCRRHGFDSRRGYLLILGRFQLVFI 42 >ref|YP_004927580.1| orf106a (mitochondrion) [Brassica carinata] gi|992329725|ref|YP_009228124.1| hypothetical protein BniMp054 (mitochondrion) [Brassica nigra] gi|335355041|gb|AEH43595.1| orf106a [Brassica carinata] gi|747023372|gb|AJD85476.1| hypothetical protein BniMp054 (mitochondrion) [Brassica nigra] Length = 106 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 38 FWSLSSSG*DIVFSCRRHGFDSRKG*VLIPGRFQLVFI 151 F SLSSSG DIVFSCRRHGFDSR+G +LI GRFQLVFI Sbjct: 8 FLSLSSSGSDIVFSCRRHGFDSRRGYLLILGRFQLVFI 45 >ref|YP_004927474.1| orf106a (mitochondrion) [Brassica oleracea] gi|335354947|gb|AEH43502.1| orf106a [Brassica oleracea] Length = 106 Score = 63.9 bits (154), Expect = 6e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 38 FWSLSSSG*DIVFSCRRHGFDSRKG*VLIPGRFQLVFI 151 F SLSSSG DIVFSCRRHGFDSR+G +LI GRFQLVFI Sbjct: 8 FLSLSSSGSDIVFSCRRHGFDSRRGYLLILGRFQLVFI 45 >gb|AGC81682.1| hypothetical protein DCGMS_00220 (mitochondrion) [Raphanus sativus] Length = 108 Score = 63.9 bits (154), Expect = 7e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 38 FWSLSSSG*DIVFSCRRHGFDSRKG*VLIPGRFQLVFI 151 F SLSSSG DIVFSCRRHGFDSR+G +LI GRFQLVFI Sbjct: 5 FLSLSSSGSDIVFSCRRHGFDSRRGYLLILGRFQLVFI 42 >ref|YP_717108.1| hypothetical protein BrnapMp009 [Brassica napus] gi|37591054|dbj|BAC98856.1| hypothetical protein [Brassica napus] Length = 106 Score = 62.0 bits (149), Expect = 3e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 38 FWSLSSSG*DIVFSCRRHGFDSRKG*VLIPGRFQLVFI 151 F SLSSSG DIVFSCRRHGFD R+G +LI GRFQLVFI Sbjct: 8 FLSLSSSGSDIVFSCRRHGFDPRRGYLLILGRFQLVFI 45