BLASTX nr result
ID: Rehmannia28_contig00034133
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00034133 (403 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102223.1| PREDICTED: cyclic phosphodiesterase-like [Se... 56 1e-07 ref|XP_011102268.1| PREDICTED: cyclic phosphodiesterase-like [Se... 57 5e-07 ref|XP_012849343.1| PREDICTED: cyclic phosphodiesterase-like [Er... 54 3e-06 >ref|XP_011102223.1| PREDICTED: cyclic phosphodiesterase-like [Sesamum indicum] Length = 122 Score = 55.8 bits (133), Expect = 1e-07 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 95 MDSTTTTASEVKRDVYSVWALPPEELTPRLK 3 M+STT+T ++VK++VYSVWALPPEELTPRLK Sbjct: 1 MESTTSTPAQVKKNVYSVWALPPEELTPRLK 31 >ref|XP_011102268.1| PREDICTED: cyclic phosphodiesterase-like [Sesamum indicum] Length = 258 Score = 56.6 bits (135), Expect = 5e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 101 ISMDSTTTTASEVKRDVYSVWALPPEELTPRLK 3 I M+STT+T ++VK++VYSVWALPPEELTPRLK Sbjct: 69 IFMESTTSTPAQVKKNVYSVWALPPEELTPRLK 101 >ref|XP_012849343.1| PREDICTED: cyclic phosphodiesterase-like [Erythranthe guttata] gi|604315428|gb|EYU28134.1| hypothetical protein MIMGU_mgv1a014457mg [Erythranthe guttata] Length = 189 Score = 53.5 bits (127), Expect = 3e-06 Identities = 24/27 (88%), Positives = 25/27 (92%) Frame = -3 Query: 83 TTTASEVKRDVYSVWALPPEELTPRLK 3 T T+ EVKRDVYSVWALPPEELTPRLK Sbjct: 6 TITSGEVKRDVYSVWALPPEELTPRLK 32