BLASTX nr result
ID: Rehmannia28_contig00033355
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00033355 (719 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103902.1| Phosphatidylinositol-4-phosphate 5-kinase 8 ... 61 3e-07 ref|XP_010533934.1| PREDICTED: phosphatidylinositol 4-phosphate ... 60 4e-07 gb|KHG13183.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like... 60 4e-07 gb|EYU26541.1| hypothetical protein MIMGU_mgv1a001773mg [Erythra... 60 8e-07 ref|XP_004299942.1| PREDICTED: phosphatidylinositol 4-phosphate ... 60 8e-07 ref|XP_011464853.1| PREDICTED: phosphatidylinositol 4-phosphate ... 60 8e-07 ref|XP_012850309.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidyl... 60 8e-07 ref|XP_006392101.1| hypothetical protein EUTSA_v10023316mg [Eutr... 59 1e-06 ref|XP_008352855.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidyl... 59 1e-06 ref|XP_006392102.1| hypothetical protein EUTSA_v10023316mg [Eutr... 59 1e-06 ref|XP_015893675.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 ref|XP_010547556.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 gb|AAG51639.1|AC018908_5 putative phosphatidylinositol-4-phospha... 59 1e-06 ref|NP_176286.2| phosphatidylinositol-4-phosphate 5-kinase 8 [Ar... 59 1e-06 ref|XP_002886578.1| phosphatidylinositol-4-phosphate 5-kinase fa... 59 1e-06 ref|XP_015893671.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 ref|XP_011087754.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 ref|XP_013733213.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 ref|XP_013612280.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 ref|XP_009113176.1| PREDICTED: phosphatidylinositol 4-phosphate ... 59 1e-06 >ref|XP_010103902.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Morus notabilis] gi|587909430|gb|EXB97343.1| Phosphatidylinositol-4-phosphate 5-kinase 8 [Morus notabilis] Length = 761 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELK 631 SSPGKSGSIFYLSHDDRFVIKTLK+PELK Sbjct: 449 SSPGKSGSIFYLSHDDRFVIKTLKRPELK 477 >ref|XP_010533934.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya hassleriana] gi|729322709|ref|XP_010533936.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya hassleriana] Length = 777 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLKK ELKV Sbjct: 450 SSPGKSGSIFYLSHDDRFVIKTLKKSELKV 479 >gb|KHG13183.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium arboreum] gi|728837630|gb|KHG17073.1| Phosphatidylinositol-4-phosphate 5-kinase 8 -like protein [Gossypium arboreum] Length = 798 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLKK ELKV Sbjct: 474 SSPGKSGSIFYLSHDDRFVIKTLKKSELKV 503 >gb|EYU26541.1| hypothetical protein MIMGU_mgv1a001773mg [Erythranthe guttata] Length = 761 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGS+FYLSHDDRFVIKTLKK ELKV Sbjct: 433 SSPGKSGSLFYLSHDDRFVIKTLKKSELKV 462 >ref|XP_004299942.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X2 [Fragaria vesca subsp. vesca] Length = 767 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGS+FYLSHDDRFVIKTLKK ELKV Sbjct: 446 SSPGKSGSLFYLSHDDRFVIKTLKKSELKV 475 >ref|XP_011464853.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X1 [Fragaria vesca subsp. vesca] Length = 769 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGS+FYLSHDDRFVIKTLKK ELKV Sbjct: 446 SSPGKSGSLFYLSHDDRFVIKTLKKSELKV 475 >ref|XP_012850309.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 5-kinase 8-like [Erythranthe guttata] Length = 771 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGS+FYLSHDDRFVIKTLKK ELKV Sbjct: 443 SSPGKSGSLFYLSHDDRFVIKTLKKSELKV 472 >ref|XP_006392101.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum] gi|557088607|gb|ESQ29387.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum] Length = 671 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 368 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 397 >ref|XP_008352855.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidylinositol 4-phosphate 5-kinase 8-like [Malus domestica] Length = 691 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTL+K ELKV Sbjct: 445 SSPGKSGSIFYLSHDDRFVIKTLRKTELKV 474 >ref|XP_006392102.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum] gi|557088608|gb|ESQ29388.1| hypothetical protein EUTSA_v10023316mg [Eutrema salsugineum] Length = 697 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 368 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 397 >ref|XP_015893675.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X2 [Ziziphus jujuba] Length = 733 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 449 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 478 >ref|XP_010547556.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya hassleriana] gi|729297526|ref|XP_010547564.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 7 [Tarenaya hassleriana] Length = 743 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGS+FYLSHDDRFV+KTLKK ELKV Sbjct: 414 SSPGKSGSLFYLSHDDRFVVKTLKKSELKV 443 >gb|AAG51639.1|AC018908_5 putative phosphatidylinositol-4-phosphate 5-kinase; 11335-7537 [Arabidopsis thaliana] Length = 769 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 444 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 473 >ref|NP_176286.2| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana] gi|75158988|sp|Q8RY89.1|PI5K8_ARATH RecName: Full=Phosphatidylinositol 4-phosphate 5-kinase 8; Short=AtPIP5K8; AltName: Full=1-phosphatidylinositol 4-phosphate kinase 8; AltName: Full=Diphosphoinositide kinase 8; AltName: Full=PtdIns(4)P-5-kinase 8 gi|18491177|gb|AAL69491.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|22136828|gb|AAM91758.1| putative phosphatidylinositol-4-phosphate 5-kinase [Arabidopsis thaliana] gi|332195623|gb|AEE33744.1| phosphatidylinositol-4-phosphate 5-kinase 8 [Arabidopsis thaliana] Length = 769 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 440 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 469 >ref|XP_002886578.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297332419|gb|EFH62837.1| phosphatidylinositol-4-phosphate 5-kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 769 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 440 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 469 >ref|XP_015893671.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X1 [Ziziphus jujuba] gi|1009151669|ref|XP_015893673.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X1 [Ziziphus jujuba] gi|1009151671|ref|XP_015893674.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 isoform X1 [Ziziphus jujuba] Length = 770 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 449 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 478 >ref|XP_011087754.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] gi|747080977|ref|XP_011087755.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] gi|747080979|ref|XP_011087757.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] gi|747080981|ref|XP_011087758.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] gi|747080983|ref|XP_011087759.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Sesamum indicum] Length = 772 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDD+FVIKTLKK ELKV Sbjct: 444 SSPGKSGSIFYLSHDDKFVIKTLKKSELKV 473 >ref|XP_013733213.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8-like [Brassica napus] Length = 773 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 444 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 473 >ref|XP_013612280.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Brassica oleracea var. oleracea] Length = 773 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 444 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 473 >ref|XP_009113176.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Brassica rapa] gi|923708176|ref|XP_013661655.1| PREDICTED: phosphatidylinositol 4-phosphate 5-kinase 8 [Brassica napus] Length = 773 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 717 SSPGKSGSIFYLSHDDRFVIKTLKKPELKV 628 SSPGKSGSIFYLSHDDRFVIKTLK+ ELKV Sbjct: 444 SSPGKSGSIFYLSHDDRFVIKTLKRSELKV 473