BLASTX nr result
ID: Rehmannia28_contig00031783
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00031783 (514 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] 58 6e-07 >emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] Length = 528 Score = 58.2 bits (139), Expect = 6e-07 Identities = 28/64 (43%), Positives = 36/64 (56%) Frame = +1 Query: 160 QTFGFPVGPSFCFAVPHNLHRRYSHLDCRIVVELHMPMLSVCDXXXXXXXXXHQSPHSCH 339 + G + PS F + +LHRR HLD R+VV++HMP+L V D Q PHSC Sbjct: 438 EALGVSIRPSLRFPLSPHLHRRRRHLDRRVVVDVHMPLLLVRDGTSRACAGADQGPHSCD 497 Query: 340 GVVY 351 GV Y Sbjct: 498 GVGY 501