BLASTX nr result
ID: Rehmannia28_contig00031622
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00031622 (351 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010527038.1| PREDICTED: probable magnesium transporter NI... 55 2e-06 >ref|XP_010527038.1| PREDICTED: probable magnesium transporter NIPA6 [Tarenaya hassleriana] Length = 346 Score = 54.7 bits (130), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 114 MIIGRFLNFFAYIYAPVVLVSPFRASSIIVSAILADVL 1 MI+G NF AYIYAP VLV+P A SIIVSA+LAD+L Sbjct: 60 MIVGEIANFIAYIYAPAVLVTPLGALSIIVSAVLADIL 97