BLASTX nr result
ID: Rehmannia28_contig00031538
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00031538 (311 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34521.1| hypothetical protein MIMGU_mgv1a018237mg [Erythra... 55 3e-07 ref|XP_011088585.1| PREDICTED: two-component response regulator ... 55 3e-07 ref|XP_012830621.1| PREDICTED: two-component response regulator ... 55 4e-07 ref|XP_012836388.1| PREDICTED: two-component response regulator ... 52 3e-06 ref|XP_010067733.1| PREDICTED: two-component response regulator ... 52 4e-06 ref|XP_015866257.1| PREDICTED: two-component response regulator ... 52 4e-06 ref|XP_011091843.1| PREDICTED: two-component response regulator ... 52 5e-06 ref|XP_009626718.1| PREDICTED: two-component response regulator ... 52 7e-06 ref|XP_010095966.1| Two-component response regulator [Morus nota... 52 8e-06 ref|XP_008446957.1| PREDICTED: two-component response regulator ... 50 8e-06 ref|XP_008799106.1| PREDICTED: two-component response regulator ... 52 9e-06 >gb|EYU34521.1| hypothetical protein MIMGU_mgv1a018237mg [Erythranthe guttata] gi|604344142|gb|EYU42941.1| hypothetical protein MIMGU_mgv1a020458mg [Erythranthe guttata] Length = 178 Score = 55.1 bits (131), Expect = 3e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 112 NNCVSTNRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 +N +ST ++ H VEVNLIITDY MP + GYDLLRKIK Sbjct: 56 SNPISTIKNHHEVEVNLIITDYCMPGINGYDLLRKIK 92 >ref|XP_011088585.1| PREDICTED: two-component response regulator ARR9-like [Sesamum indicum] Length = 183 Score = 55.1 bits (131), Expect = 3e-07 Identities = 26/35 (74%), Positives = 31/35 (88%), Gaps = 2/35 (5%) Frame = -2 Query: 100 STNRSTHH--VEVNLIITDYSMPSVTGYDLLRKIK 2 +TN ++HH VEVNLIITDY MP++TGYDLLRKIK Sbjct: 59 NTNSNSHHHKVEVNLIITDYCMPAITGYDLLRKIK 93 >ref|XP_012830621.1| PREDICTED: two-component response regulator ARR8-like [Erythranthe guttata] Length = 190 Score = 55.1 bits (131), Expect = 4e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 112 NNCVSTNRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 +N +ST ++ H VEVNLIITDY MP + GYDLLRKIK Sbjct: 68 SNPISTIKNHHEVEVNLIITDYCMPGINGYDLLRKIK 104 >ref|XP_012836388.1| PREDICTED: two-component response regulator ARR9-like [Erythranthe guttata] gi|604334089|gb|EYU38278.1| hypothetical protein MIMGU_mgv1a019913mg [Erythranthe guttata] Length = 147 Score = 52.0 bits (123), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 94 NRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 + +T VE+NLIITDYSMP+VTGYDLLRKIK Sbjct: 60 SNNTLKVEINLIITDYSMPAVTGYDLLRKIK 90 >ref|XP_010067733.1| PREDICTED: two-component response regulator ARR9-like [Eucalyptus grandis] gi|629100155|gb|KCW65920.1| hypothetical protein EUGRSUZ_G03236 [Eucalyptus grandis] Length = 183 Score = 52.4 bits (124), Expect = 4e-06 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -2 Query: 109 NCVSTNRSTHH--VEVNLIITDYSMPSVTGYDLLRKIK 2 N S + S HH +EVNLIITDY MP +TGYDLLRKIK Sbjct: 59 NATSVSPSYHHQEIEVNLIITDYFMPEMTGYDLLRKIK 96 >ref|XP_015866257.1| PREDICTED: two-component response regulator ORR9-like [Ziziphus jujuba] Length = 169 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -2 Query: 103 VSTNRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 VS N +EVNLIITDYSMP +TGYDLLRKIK Sbjct: 83 VSPNNLNQDLEVNLIITDYSMPRMTGYDLLRKIK 116 >ref|XP_011091843.1| PREDICTED: two-component response regulator ARR8-like [Sesamum indicum] Length = 187 Score = 52.0 bits (123), Expect = 5e-06 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 2/36 (5%) Frame = -2 Query: 103 VSTNRSTH--HVEVNLIITDYSMPSVTGYDLLRKIK 2 VST ++ H VEVNLIITDY MP +TGYDLLRKIK Sbjct: 64 VSTTKNHHVCEVEVNLIITDYCMPGITGYDLLRKIK 99 >ref|XP_009626718.1| PREDICTED: two-component response regulator ARR8-like isoform X1 [Nicotiana tomentosiformis] Length = 229 Score = 52.0 bits (123), Expect = 7e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -2 Query: 115 PNNCVSTNRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 P+ C +++ VEVNLIITDY MP +TGYDLL+KIK Sbjct: 61 PHACPHNHQNLQEVEVNLIITDYCMPGMTGYDLLKKIK 98 >ref|XP_010095966.1| Two-component response regulator [Morus notabilis] gi|587873474|gb|EXB62659.1| Two-component response regulator [Morus notabilis] Length = 195 Score = 51.6 bits (122), Expect = 8e-06 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -2 Query: 109 NCVSTNRSTHH--VEVNLIITDYSMPSVTGYDLLRKIK 2 N S + S HH +EVNLIITDY MP +TGYDLLRKIK Sbjct: 60 NIPSVSPSNHHQVLEVNLIITDYCMPGMTGYDLLRKIK 97 >ref|XP_008446957.1| PREDICTED: two-component response regulator ARR8-like isoform X2 [Cucumis melo] Length = 108 Score = 50.1 bits (118), Expect = 8e-06 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 2/33 (6%) Frame = -2 Query: 94 NRSTHH--VEVNLIITDYSMPSVTGYDLLRKIK 2 +R HH +EVNLIITDY MP +TGYDLLRKIK Sbjct: 70 HRQHHHQEIEVNLIITDYCMPEMTGYDLLRKIK 102 >ref|XP_008799106.1| PREDICTED: two-component response regulator ARR17-like isoform X2 [Phoenix dactylifera] Length = 212 Score = 51.6 bits (122), Expect = 9e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -2 Query: 112 NNCVSTNRSTHHVEVNLIITDYSMPSVTGYDLLRKIK 2 +N S + + H +EVNL+ITDY MP +TGYDLL+KIK Sbjct: 55 SNTPSVSPNQHEIEVNLVITDYCMPGMTGYDLLKKIK 91