BLASTX nr result
ID: Rehmannia28_contig00031361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00031361 (934 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081044.1| PREDICTED: prohibitin-1, mitochondrial-like ... 66 5e-09 >ref|XP_011081044.1| PREDICTED: prohibitin-1, mitochondrial-like [Sesamum indicum] gi|747068569|ref|XP_011081045.1| PREDICTED: prohibitin-1, mitochondrial-like [Sesamum indicum] Length = 269 Score = 66.2 bits (160), Expect = 5e-09 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +2 Query: 803 LYWDLARLTVAGAAVVETFKRTYYNVEGGHRALEFNRFTGTKDK 934 L W++ ++ GA +V TF +TYYNVEGGHRA+EFNRFTG K+K Sbjct: 3 LKWEVMKIAAVGATIVNTFGKTYYNVEGGHRAVEFNRFTGIKNK 46