BLASTX nr result
ID: Rehmannia28_contig00031145
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00031145 (307 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078833.1| PREDICTED: uncharacterized protein LOC105162... 49 9e-06 >ref|XP_011078833.1| PREDICTED: uncharacterized protein LOC105162500 [Sesamum indicum] Length = 229 Score = 49.3 bits (116), Expect(2) = 9e-06 Identities = 24/45 (53%), Positives = 31/45 (68%) Frame = +1 Query: 73 EHRDDKLVLVLVHTYSVLGKFQGLLNDIALRIVHWGIIDITFVMR 207 EH++ LV+VLVH YSVLG FQGL+ IA + G+ +TF MR Sbjct: 35 EHQNSNLVVVLVHPYSVLGGFQGLMKGIARGLADRGLAAVTFDMR 79 Score = 26.9 bits (58), Expect(2) = 9e-06 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = +2 Query: 35 GITMDARIYRPA 70 G+T+DARIYRPA Sbjct: 19 GVTLDARIYRPA 30