BLASTX nr result
ID: Rehmannia28_contig00030426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030426 (431 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014632631.1| PREDICTED: uncharacterized protein LOC102665... 53 2e-06 gb|KYP41987.1| hypothetical protein KK1_036603 [Cajanus cajan] 50 9e-06 >ref|XP_014632631.1| PREDICTED: uncharacterized protein LOC102665394 [Glycine max] Length = 130 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = +2 Query: 287 GGSKLPYDFDSITGKTERLHQVKLSTYLGTLARDKVSILYSTWRHVP 427 G + + D TGK + LH+ KL TYLG +ARDKV + Y TW+ VP Sbjct: 46 GAERPVVNVDPATGKADGLHKKKLRTYLGVVARDKVDVTYETWKEVP 92 >gb|KYP41987.1| hypothetical protein KK1_036603 [Cajanus cajan] Length = 79 Score = 50.4 bits (119), Expect = 9e-06 Identities = 23/49 (46%), Positives = 32/49 (65%) Frame = +2 Query: 284 MGGSKLPYDFDSITGKTERLHQVKLSTYLGTLARDKVSILYSTWRHVPE 430 M G K+ D D TG ++ + S+YLGTLARDK+SIL +W+ VP+ Sbjct: 9 MKGPKISLDVDPTTGIVSGPNKAQFSSYLGTLARDKISILVPSWKEVPQ 57