BLASTX nr result
ID: Rehmannia28_contig00030387
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030387 (356 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containi... 178 5e-50 gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythra... 155 6e-42 ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containi... 155 7e-42 emb|CDP04793.1| unnamed protein product [Coffea canephora] 101 8e-23 ref|XP_010094870.1| hypothetical protein L484_016452 [Morus nota... 94 5e-20 emb|CBI21003.3| unnamed protein product [Vitis vinifera] 89 2e-18 ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-18 ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-18 ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containi... 88 5e-18 ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containi... 88 5e-18 ref|XP_002309609.2| pentatricopeptide repeat-containing family p... 86 2e-17 ref|XP_015877414.1| PREDICTED: pentatricopeptide repeat-containi... 85 7e-17 ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-16 ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citr... 83 3e-16 ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containi... 82 4e-16 ref|XP_015965658.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-15 ref|XP_011019771.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-15 ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-15 ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containi... 80 3e-15 ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-15 >ref|XP_011081936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070249|ref|XP_011081937.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070251|ref|XP_011081938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] gi|747070253|ref|XP_011081939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Sesamum indicum] Length = 859 Score = 178 bits (452), Expect = 5e-50 Identities = 88/117 (75%), Positives = 98/117 (83%) Frame = +2 Query: 5 ETTSIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSAL 184 E +P+ +SDS+EANP SEPQ SIKI T Q P ++NTRLSQ +VVDTLLSHINDP +AL Sbjct: 40 EIAGVPVRSSDSVEANPASEPQNSIKIQTFQNPFADNTRLSQIYVVDTLLSHINDPLAAL 99 Query: 185 EYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 EYF VEKQ GFVREIGDSFFVL+HILVSSR+HHG RNLLNNYLSGD APSG VLV Sbjct: 100 EYFRSVEKQPGFVREIGDSFFVLLHILVSSRDHHGAARNLLNNYLSGDSAPSGVVLV 156 >gb|EYU21955.1| hypothetical protein MIMGU_mgv1a001349mg [Erythranthe guttata] Length = 836 Score = 155 bits (393), Expect = 6e-42 Identities = 82/118 (69%), Positives = 88/118 (74%) Frame = +2 Query: 2 EETTSIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSA 181 +ETTS P+ NS EPQ IKI T Q PISEN RLSQA VV+TLLS+ NDP SA Sbjct: 38 DETTSTPITNS---------EPQNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSA 88 Query: 182 LEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 L+YF W EKQRGFVREIGDSF VL+HILVSS HHG RNLLNNYLS D APSG VLV Sbjct: 89 LDYFRWAEKQRGFVREIGDSFLVLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLV 146 >ref|XP_012855980.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Erythranthe guttata] Length = 849 Score = 155 bits (393), Expect = 7e-42 Identities = 82/118 (69%), Positives = 88/118 (74%) Frame = +2 Query: 2 EETTSIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSA 181 +ETTS P+ NS EPQ IKI T Q PISEN RLSQA VV+TLLS+ NDP SA Sbjct: 38 DETTSTPITNS---------EPQNPIKIQTFQKPISENPRLSQANVVETLLSNFNDPRSA 88 Query: 182 LEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 L+YF W EKQRGFVREIGDSF VL+HILVSS HHG RNLLNNYLS D APSG VLV Sbjct: 89 LDYFRWAEKQRGFVREIGDSFLVLLHILVSSHYHHGSARNLLNNYLSSDSAPSGGVLV 146 >emb|CDP04793.1| unnamed protein product [Coffea canephora] Length = 856 Score = 101 bits (252), Expect = 8e-23 Identities = 56/124 (45%), Positives = 75/124 (60%), Gaps = 10/124 (8%) Frame = +2 Query: 11 TSIPLPNSDSI---EANPTSEPQTSIKIPTCQT-------PISENTRLSQAFVVDTLLSH 160 T P P + I ++ + P+ S KI PISEN LSQ VV++LLSH Sbjct: 29 TLTPEPENPQIVPSDSQGSKNPEFSSKIQILSNLNENWKKPISENPGLSQTHVVESLLSH 88 Query: 161 INDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPS 340 NDP++A +YF W E QRGF+R + D + VL+HILVSS N + R LLN+Y+S D +PS Sbjct: 89 RNDPAAAFKYFQWAEGQRGFLRGVSDPYCVLLHILVSSPNEYSLTRRLLNSYVSSDSSPS 148 Query: 341 GAVL 352 G +L Sbjct: 149 GILL 152 >ref|XP_010094870.1| hypothetical protein L484_016452 [Morus notabilis] gi|587868026|gb|EXB57399.1| hypothetical protein L484_016452 [Morus notabilis] Length = 907 Score = 93.6 bits (231), Expect = 5e-20 Identities = 49/114 (42%), Positives = 72/114 (63%) Frame = +2 Query: 14 SIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYF 193 S+ + D + S + + ++ + S +T L+QA V++TLLSH NDP SAL+YF Sbjct: 48 SLATKSLDEFTSESNSAEKPTSEVDPNRNLCSLSTDLTQAHVINTLLSHKNDPYSALKYF 107 Query: 194 NWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 W E+ RGF+R + DSF VL+HIL+ S+ HG ++LL+ Y+SGD PS V V Sbjct: 108 KWAERMRGFIRGV-DSFSVLLHILMGSQETHGSAQSLLSLYVSGDSGPSANVFV 160 >emb|CBI21003.3| unnamed protein product [Vitis vinifera] Length = 837 Score = 89.0 bits (219), Expect = 2e-18 Identities = 48/91 (52%), Positives = 58/91 (63%) Frame = +2 Query: 83 IPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHI 262 +PT Q E T LSQ V+D LL H+NDP SAL YF E QRGF+R + D++ VL+HI Sbjct: 46 VPTSQIH-QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHI 103 Query: 263 LVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 L+ S HG R LLN Y+SGD PS V V Sbjct: 104 LMRSPETHGHARKLLNRYVSGDSDPSPVVFV 134 >ref|XP_003631789.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385776|ref|XP_010648630.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385778|ref|XP_010648631.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385781|ref|XP_010648632.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385783|ref|XP_010648633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] gi|731385785|ref|XP_010648634.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Vitis vinifera] Length = 877 Score = 89.0 bits (219), Expect = 2e-18 Identities = 48/91 (52%), Positives = 58/91 (63%) Frame = +2 Query: 83 IPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHI 262 +PT Q E T LSQ V+D LL H+NDP SAL YF E QRGF+R + D++ VL+HI Sbjct: 86 VPTSQIH-QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHI 143 Query: 263 LVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 L+ S HG R LLN Y+SGD PS V V Sbjct: 144 LMRSPETHGHARKLLNRYVSGDSDPSPVVFV 174 >ref|XP_010648635.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X3 [Vitis vinifera] Length = 1204 Score = 89.0 bits (219), Expect = 2e-18 Identities = 48/91 (52%), Positives = 58/91 (63%) Frame = +2 Query: 83 IPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHI 262 +PT Q E T LSQ V+D LL H+NDP SAL YF E QRGF+R + D++ VL+HI Sbjct: 413 VPTSQIH-QETTPLSQNHVIDALLCHVNDPQSALRYFKRAETQRGFIRGV-DAYCVLLHI 470 Query: 263 LVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 L+ S HG R LLN Y+SGD PS V V Sbjct: 471 LMRSPETHGHARKLLNRYVSGDSDPSPVVFV 501 >ref|XP_009784742.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474596|ref|XP_009784743.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474598|ref|XP_009784744.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] gi|698474601|ref|XP_009784745.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana sylvestris] Length = 864 Score = 87.8 bits (216), Expect = 5e-18 Identities = 53/117 (45%), Positives = 64/117 (54%), Gaps = 7/117 (5%) Frame = +2 Query: 23 LPNSDSIEANPTSEPQTSIKIP-------TCQTPISENTRLSQAFVVDTLLSHINDPSSA 181 L SDS+E P PQ S K +C PISE+ ++ VVD LLSH +DP SA Sbjct: 44 LSPSDSLE-KPILNPQESGKPVLLHDVDHSCDKPISEDGGFTKNHVVDVLLSHRDDPDSA 102 Query: 182 LEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVL 352 YF +QRGF+ D FFVL+HILVSS H R LL+NY D PS V+ Sbjct: 103 YRYFQTARQQRGFLHTKSDPFFVLLHILVSSTMHQHKARRLLDNYAFSDSGPSATVV 159 >ref|XP_009615415.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122855|ref|XP_009615416.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122857|ref|XP_009615417.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697122859|ref|XP_009615418.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 87.8 bits (216), Expect = 5e-18 Identities = 52/117 (44%), Positives = 64/117 (54%), Gaps = 7/117 (5%) Frame = +2 Query: 23 LPNSDSIEANPTSEPQTSIKIP-------TCQTPISENTRLSQAFVVDTLLSHINDPSSA 181 L SDS+E P PQ S K+ +C P SE+ ++ VVD LLSH +DP SA Sbjct: 44 LSPSDSLE-KPILNPQDSEKLVPLHDIDHSCDRPNSEDGGFTKNHVVDVLLSHRDDPDSA 102 Query: 182 LEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVL 352 YF +QRGF+ D FFVL+HILVSS H R LL+NY D PS V+ Sbjct: 103 YRYFQTARQQRGFLHTKSDPFFVLLHILVSSTMHQHKARRLLDNYAFSDSGPSATVI 159 >ref|XP_002309609.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550337148|gb|EEE93132.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 841 Score = 86.3 bits (212), Expect = 2e-17 Identities = 44/111 (39%), Positives = 63/111 (56%) Frame = +2 Query: 23 LPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWV 202 LPN E + P + P P S+++ L+Q +DTLL+H NDP SAL YF W Sbjct: 29 LPNIPISETPLSQNPHPNTNFPGKSAPTSQDSFLTQTQYIDTLLNHQNDPQSALSYFTWA 88 Query: 203 EKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 ++RG ++ + D+ VL+HIL S G RNLLN + S D+ P +V+V Sbjct: 89 SQKRGLIKSV-DALCVLLHILTKSTETCGKARNLLNRFASDDWGPVPSVVV 138 >ref|XP_015877414.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Ziziphus jujuba] gi|1009107011|ref|XP_015877421.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Ziziphus jujuba] Length = 820 Score = 84.7 bits (208), Expect = 7e-17 Identities = 43/84 (51%), Positives = 56/84 (66%) Frame = +2 Query: 89 TCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILV 268 T +P S++ + A V++TLLSH +DP SA YF W EK RGFV+ I D F VL+H+L+ Sbjct: 30 TPSSPDSKDHDFTPANVINTLLSHRSDPRSAFTYFKWAEKMRGFVKAI-DVFCVLLHVLM 88 Query: 269 SSRNHHGPVRNLLNNYLSGDFAPS 340 S + HG RNLLN Y+S D PS Sbjct: 89 GSPDTHGAARNLLNQYVSSDSGPS 112 >ref|XP_009604239.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190350|ref|XP_009604240.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] gi|697190352|ref|XP_009604241.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Nicotiana tomentosiformis] Length = 864 Score = 84.0 bits (206), Expect = 1e-16 Identities = 51/117 (43%), Positives = 63/117 (53%), Gaps = 7/117 (5%) Frame = +2 Query: 23 LPNSDSIEANPTSEPQTSIK-IP------TCQTPISENTRLSQAFVVDTLLSHINDPSSA 181 L SDS+E P PQ S K +P +C P S++ ++ VVD LLSH +DP SA Sbjct: 44 LSPSDSLE-KPILNPQDSEKPVPLHDIDHSCDRPFSKDGGFTKNHVVDVLLSHRDDPDSA 102 Query: 182 LEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVL 352 YF QRGF+ D FFVL+HILVS H R LL+NY D PS V+ Sbjct: 103 YRYFQTARLQRGFLHTKSDPFFVLLHILVSCTMHQHKARRLLDNYAFSDSGPSATVI 159 >ref|XP_006450492.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] gi|568859583|ref|XP_006483317.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Citrus sinensis] gi|557553718|gb|ESR63732.1| hypothetical protein CICLE_v10010816mg [Citrus clementina] Length = 850 Score = 82.8 bits (203), Expect = 3e-16 Identities = 52/137 (37%), Positives = 75/137 (54%), Gaps = 25/137 (18%) Frame = +2 Query: 20 PLPNSDSIEANPTSEPQTSIKIPTCQTPISEN-------------------------TRL 124 P N+ SI S+PQ+S K + ++P+SEN T L Sbjct: 17 PFKNTKSI----CSQPQSSEKPISSESPVSENFPEKITKGSHFSGNPIFPESNTFQPTDL 72 Query: 125 SQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNL 304 SQ V+ +LLS N+P SA EYF VE++RGF++ + D+F VL+HIL+ R H RNL Sbjct: 73 SQTSVISSLLSCRNEPVSAFEYFKRVERRRGFLKSL-DTFCVLLHILMKDRESHRYARNL 131 Query: 305 LNNYLSGDFAPSGAVLV 355 LN+Y+SG P+ A ++ Sbjct: 132 LNHYVSGGSEPTSAAII 148 >ref|XP_008370080.1| PREDICTED: pentatricopeptide repeat-containing protein At2g39230, mitochondrial-like [Malus domestica] Length = 860 Score = 82.4 bits (202), Expect = 4e-16 Identities = 41/85 (48%), Positives = 57/85 (67%) Frame = +2 Query: 101 PISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILVSSRN 280 PIS+++ L+Q V+ TLLSH + P SA++YF W E++RG VR + D+ VL+HIL+ S N Sbjct: 81 PISQDSELTQTSVISTLLSHKSKPYSAIKYFKWAERERGLVRGV-DAVCVLLHILMGSPN 139 Query: 281 HHGPVRNLLNNYLSGDFAPSGAVLV 355 H + LLN Y+SGD P V V Sbjct: 140 THERAKMLLNQYVSGDSGPVPGVFV 164 >ref|XP_015965658.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Arachis duranensis] Length = 881 Score = 80.9 bits (198), Expect = 1e-15 Identities = 51/119 (42%), Positives = 71/119 (59%), Gaps = 5/119 (4%) Frame = +2 Query: 14 SIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTR-----LSQAFVVDTLLSHINDPSS 178 S PLP+S S + S KI IS + +S+ V+DTLLSH DP S Sbjct: 64 SDPLPHSQSQDPANGPSSHFSKKIDDFPMKISAEAQSHLEVISKEGVLDTLLSHKLDPKS 123 Query: 179 ALEYFNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 AL++F VE++RGFV+ + D +L+HIL SS + +G +RNLLNNY+ D +P+ VLV Sbjct: 124 ALKFFKGVERRRGFVKTV-DVLCLLVHILASSPDTYGVLRNLLNNYVFADSSPTVRVLV 181 >ref|XP_011019771.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Populus euphratica] Length = 841 Score = 80.5 bits (197), Expect = 2e-15 Identities = 41/111 (36%), Positives = 63/111 (56%) Frame = +2 Query: 23 LPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWV 202 LPN+ E + P + P +P S+++ L+ +DTLL++ DP SAL YF W Sbjct: 29 LPNNPISETPLSQNPHPNTNFPGKSSPTSQDSFLTLTQYIDTLLNYQTDPQSALSYFTWA 88 Query: 203 EKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 ++RG ++ + D+ VL+HIL S G RNLLN + S D+ P +V+V Sbjct: 89 SQKRGLIKSV-DALCVLLHILTKSTETCGKARNLLNRFASDDWGPLPSVVV 138 >ref|XP_004245400.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722828|ref|XP_010325115.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722831|ref|XP_010325116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722834|ref|XP_010325117.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722837|ref|XP_010325118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722840|ref|XP_010325119.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] gi|723722845|ref|XP_010325120.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial [Solanum lycopersicum] Length = 850 Score = 80.5 bits (197), Expect = 2e-15 Identities = 41/88 (46%), Positives = 52/88 (59%) Frame = +2 Query: 89 TCQTPISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILV 268 +C P SE+ + ++ VVD LLSH +DP SA YF QRGF+ D FFVL+HILV Sbjct: 57 SCGRPNSEDVKFTKNHVVDVLLSHRDDPDSAYRYFQTARLQRGFLHSKSDPFFVLLHILV 116 Query: 269 SSRNHHGPVRNLLNNYLSGDFAPSGAVL 352 +S H R LL+ Y S D PS V+ Sbjct: 117 NSAMHQHKSRRLLDYYASSDSGPSATVV 144 >ref|XP_004514126.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like [Cicer arietinum] Length = 850 Score = 80.1 bits (196), Expect = 3e-15 Identities = 49/115 (42%), Positives = 69/115 (60%) Frame = +2 Query: 11 TSIPLPNSDSIEANPTSEPQTSIKIPTCQTPISENTRLSQAFVVDTLLSHINDPSSALEY 190 +SIP N T+ P I P I +T SQ ++DTLL+H ++P SAL++ Sbjct: 38 SSIPPNNLRPFSQLSTNFPDKIISTPNFPEKII-STSNSQNQILDTLLTHKSNPKSALKF 96 Query: 191 FNWVEKQRGFVREIGDSFFVLIHILVSSRNHHGPVRNLLNNYLSGDFAPSGAVLV 355 F VE++RGFV+ + D F +L+ IL S+ H +RNLLNNY+ GD +PS VLV Sbjct: 97 FKGVERKRGFVKTV-DVFSLLLQILSSTPQTHSSLRNLLNNYVFGDSSPSPKVLV 150 >ref|XP_009377786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X1 [Pyrus x bretschneideri] gi|694405904|ref|XP_009377787.1| PREDICTED: pentatricopeptide repeat-containing protein At3g54980, mitochondrial-like isoform X2 [Pyrus x bretschneideri] Length = 860 Score = 79.3 bits (194), Expect = 5e-15 Identities = 40/85 (47%), Positives = 56/85 (65%) Frame = +2 Query: 101 PISENTRLSQAFVVDTLLSHINDPSSALEYFNWVEKQRGFVREIGDSFFVLIHILVSSRN 280 P S+++ L+Q V+ TLLSH + P SA++YF W E++RGFVR + D+ VL+HIL+ S N Sbjct: 81 PTSQDSELTQTSVISTLLSHKSKPYSAVKYFKWAERERGFVRGV-DAVCVLLHILMGSPN 139 Query: 281 HHGPVRNLLNNYLSGDFAPSGAVLV 355 + LLN Y+SGD P V V Sbjct: 140 TQERAKMLLNQYVSGDSGPVPGVFV 164