BLASTX nr result
ID: Rehmannia28_contig00030323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030323 (425 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009761074.1| PREDICTED: replication protein A 70 kDa DNA-... 47 3e-06 >ref|XP_009761074.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit A-like [Nicotiana sylvestris] Length = 302 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 18/44 (40%), Positives = 30/44 (68%) Frame = +2 Query: 38 YRNNRLSCTLWEEYVDMILPYLEEHTFEPLIVILQMCRAKVFRG 169 + N + T W E+VD ILP+LE ++P+IV++Q+ +A F+G Sbjct: 108 HERNNILATFWGEFVDQILPHLEGSLYQPVIVVMQLIKAHKFQG 151 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 268 VSNTFHVTKMIVNGDIEEIADFKRR 342 V NT+HV+K+ +N D+ + DFK R Sbjct: 155 VRNTWHVSKLWINPDLPQAVDFKSR 179