BLASTX nr result
ID: Rehmannia28_contig00030160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030160 (486 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077289.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Ses... 56 3e-06 >ref|XP_011077289.1| PREDICTED: protein SHOOT GRAVITROPISM 6 [Sesamum indicum] Length = 1726 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 155 IYNYVLGHILYLF*FVV*SSGEDERSRAEQLLHILRQIDPYVSSSV 292 + N ++ +++ L ++ +SGED RSRAEQLLHILRQIDPYVSSSV Sbjct: 915 VMNGLIHNLITLLCAILVTSGEDGRSRAEQLLHILRQIDPYVSSSV 960