BLASTX nr result
ID: Rehmannia28_contig00030030
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00030030 (411 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071285.1| PREDICTED: two-component response regulator ... 129 4e-35 ref|XP_011086463.1| PREDICTED: two-component response regulator ... 128 2e-34 ref|XP_012847768.1| PREDICTED: two-component response regulator ... 125 3e-33 ref|XP_009763113.1| PREDICTED: two-component response regulator ... 111 7e-29 ref|XP_009763112.1| PREDICTED: two-component response regulator ... 111 8e-29 emb|CDP00229.1| unnamed protein product [Coffea canephora] 114 1e-28 ref|XP_009763111.1| PREDICTED: two-component response regulator ... 111 1e-27 ref|XP_002520201.1| PREDICTED: two-component response regulator ... 109 7e-27 ref|XP_015168830.1| PREDICTED: two-component response regulator ... 103 7e-25 ref|XP_010100530.1| Two-component response regulator [Morus nota... 103 8e-25 ref|XP_012092019.1| PREDICTED: two-component response regulator ... 103 2e-24 ref|NP_001305076.1| two-component response regulator ARR5 [Solan... 101 8e-24 ref|XP_015076860.1| PREDICTED: two-component response regulator ... 101 8e-24 ref|XP_007044474.1| Two-component response regulator ARR4 [Theob... 101 5e-23 ref|XP_012458513.1| PREDICTED: two-component response regulator ... 99 7e-23 gb|KHG13999.1| Two-component response regulator ARR4 -like prote... 99 7e-23 ref|XP_004297679.1| PREDICTED: two-component response regulator ... 99 7e-23 gb|KJB77155.1| hypothetical protein B456_012G123500 [Gossypium r... 99 8e-23 ref|XP_008389572.1| PREDICTED: two-component response regulator ... 97 2e-22 ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prun... 97 3e-22 >ref|XP_011071285.1| PREDICTED: two-component response regulator ARR5-like [Sesamum indicum] Length = 222 Score = 129 bits (325), Expect = 4e-35 Identities = 67/77 (87%), Positives = 72/77 (93%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVD-RKVIERLLKITSCKVTA 360 MAKNGVFSRLRRL+++E D+FSAC DSHEVHVLAVDDSLVD RKVIERLLKIT+CKVTA Sbjct: 1 MAKNGVFSRLRRLEKSEDTDEFSACIDSHEVHVLAVDDSLVDNRKVIERLLKITACKVTA 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSGR ALQFLGLDEEE Sbjct: 61 VDSGRSALQFLGLDEEE 77 >ref|XP_011086463.1| PREDICTED: two-component response regulator ARR17 [Sesamum indicum] Length = 240 Score = 128 bits (321), Expect = 2e-34 Identities = 67/77 (87%), Positives = 71/77 (92%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSH-EVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 MAKNGVFSRLRRL++ EGVDD SA +D+H EVHVLAVDDSLVDRKVIERLLKIT CKVTA Sbjct: 1 MAKNGVFSRLRRLEKGEGVDDLSAYSDTHHEVHVLAVDDSLVDRKVIERLLKITCCKVTA 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSG RALQFLGLDEEE Sbjct: 61 VDSGMRALQFLGLDEEE 77 >ref|XP_012847768.1| PREDICTED: two-component response regulator ARR5 [Erythranthe guttata] gi|604316462|gb|EYU28654.1| hypothetical protein MIMGU_mgv1a012764mg [Erythranthe guttata] Length = 241 Score = 125 bits (314), Expect = 3e-33 Identities = 65/79 (82%), Positives = 71/79 (89%), Gaps = 3/79 (3%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACN---DSHEVHVLAVDDSLVDRKVIERLLKITSCKV 354 M+KNGVFSRLRRL++ EGVD++ N DS EVHVLAVDDSLVDRKVIE+LLKITSCKV Sbjct: 1 MSKNGVFSRLRRLEKVEGVDEYEYANPSCDSDEVHVLAVDDSLVDRKVIEKLLKITSCKV 60 Query: 355 TAVDSGRRALQFLGLDEEE 411 TAVDSGRRALQFLGLDEEE Sbjct: 61 TAVDSGRRALQFLGLDEEE 79 >ref|XP_009763113.1| PREDICTED: two-component response regulator ARR3-like isoform X3 [Nicotiana sylvestris] Length = 144 Score = 111 bits (277), Expect = 7e-29 Identities = 58/76 (76%), Positives = 63/76 (82%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NGVFSR R ++ E D+ DS EVHVLAVDDSLVDRKVIERLLKITSC+VT V Sbjct: 1 MARNGVFSRRWRAEKMEEFDNLCPSLDSDEVHVLAVDDSLVDRKVIERLLKITSCRVTTV 60 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEEE Sbjct: 61 DSGRRALQFLGLDEEE 76 >ref|XP_009763112.1| PREDICTED: two-component response regulator ARR3-like isoform X2 [Nicotiana sylvestris] Length = 147 Score = 111 bits (277), Expect = 8e-29 Identities = 58/76 (76%), Positives = 63/76 (82%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NGVFSR R ++ E D+ DS EVHVLAVDDSLVDRKVIERLLKITSC+VT V Sbjct: 1 MARNGVFSRRWRAEKMEEFDNLCPSLDSDEVHVLAVDDSLVDRKVIERLLKITSCRVTTV 60 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEEE Sbjct: 61 DSGRRALQFLGLDEEE 76 >emb|CDP00229.1| unnamed protein product [Coffea canephora] Length = 251 Score = 114 bits (284), Expect = 1e-28 Identities = 61/77 (79%), Positives = 66/77 (85%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACN-DSHEVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 MA+NGVFSR RR +R E D SA + SHEVHVLAVDDSLVDRKVIE+LLK TSCKVTA Sbjct: 1 MARNGVFSRRRRPERMEEAGDLSATSLGSHEVHVLAVDDSLVDRKVIEKLLKTTSCKVTA 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSGRRALQFLGLDEE+ Sbjct: 61 VDSGRRALQFLGLDEEK 77 >ref|XP_009763111.1| PREDICTED: two-component response regulator ARR6-like isoform X1 [Nicotiana sylvestris] Length = 262 Score = 111 bits (277), Expect = 1e-27 Identities = 58/76 (76%), Positives = 63/76 (82%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NGVFSR R ++ E D+ DS EVHVLAVDDSLVDRKVIERLLKITSC+VT V Sbjct: 1 MARNGVFSRRWRAEKMEEFDNLCPSLDSDEVHVLAVDDSLVDRKVIERLLKITSCRVTTV 60 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEEE Sbjct: 61 DSGRRALQFLGLDEEE 76 >ref|XP_002520201.1| PREDICTED: two-component response regulator ARR5 [Ricinus communis] gi|223540693|gb|EEF42256.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 258 Score = 109 bits (272), Expect = 7e-27 Identities = 59/76 (77%), Positives = 67/76 (88%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG+ SR R ++ EG + FS+C D+ EVHVLAVDDSLVDRKVIERLLKITSCKVTAV Sbjct: 1 MARNGIASRRWRSEKIEGFE-FSSC-DNDEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 58 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEE+ Sbjct: 59 DSGRRALQFLGLDEEK 74 >ref|XP_015168830.1| PREDICTED: two-component response regulator ARR5-like [Solanum tuberosum] Length = 248 Score = 103 bits (258), Expect = 7e-25 Identities = 54/77 (70%), Positives = 63/77 (81%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDS-HEVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 MA+NG+FSR RR ++ E D+ ++ HEVHVLAVDDSLVDR VIERLLKITSCKVT Sbjct: 1 MARNGMFSRRRRAEKVEEYDELLPLTEATHEVHVLAVDDSLVDRIVIERLLKITSCKVTT 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSG RAL++LGLDEEE Sbjct: 61 VDSGMRALKYLGLDEEE 77 >ref|XP_010100530.1| Two-component response regulator [Morus notabilis] gi|587894132|gb|EXB82664.1| Two-component response regulator [Morus notabilis] Length = 239 Score = 103 bits (257), Expect = 8e-25 Identities = 57/76 (75%), Positives = 64/76 (84%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG S RR ++ +G + FS DS EVHVLAVDDSLVDRKVIERLL+ITSCKVTAV Sbjct: 1 MARNGTVSWRRRSEKVDGFE-FSPV-DSEEVHVLAVDDSLVDRKVIERLLRITSCKVTAV 58 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEE+ Sbjct: 59 DSGRRALQFLGLDEEK 74 >ref|XP_012092019.1| PREDICTED: two-component response regulator ARR5 [Jatropha curcas] gi|643704220|gb|KDP21284.1| hypothetical protein JCGZ_21755 [Jatropha curcas] Length = 252 Score = 103 bits (256), Expect = 2e-24 Identities = 54/76 (71%), Positives = 63/76 (82%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG+ SR R D+ + + S +D EVHVLAVDDSL+DRKVIERLLKI+SCKVTAV Sbjct: 1 MARNGIVSRHWRSDKLDAFN-LSPSSDDQEVHVLAVDDSLIDRKVIERLLKISSCKVTAV 59 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEE+ Sbjct: 60 DSGRRALQFLGLDEEK 75 >ref|NP_001305076.1| two-component response regulator ARR5 [Solanum lycopersicum] Length = 251 Score = 101 bits (251), Expect = 8e-24 Identities = 53/77 (68%), Positives = 62/77 (80%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDS-HEVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 MA+NG+FSR RR ++ E D+ ++ HEVHVLAVDDSLVDR VIERLLK TSCKVT Sbjct: 1 MARNGMFSRRRRAEKVEEYDELLPLTEATHEVHVLAVDDSLVDRIVIERLLKNTSCKVTT 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSG RAL++LGLDEEE Sbjct: 61 VDSGMRALKYLGLDEEE 77 >ref|XP_015076860.1| PREDICTED: two-component response regulator ARR5-like [Solanum pennellii] Length = 252 Score = 101 bits (251), Expect = 8e-24 Identities = 53/77 (68%), Positives = 62/77 (80%), Gaps = 1/77 (1%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDS-HEVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 MA+NG+FSR RR ++ E D+ ++ HEVHVLAVDDSLVDR VIERLLK TSCKVT Sbjct: 1 MARNGMFSRRRRAEKVEEYDELLPLTEATHEVHVLAVDDSLVDRIVIERLLKNTSCKVTT 60 Query: 361 VDSGRRALQFLGLDEEE 411 VDSG RAL++LGLDEEE Sbjct: 61 VDSGMRALKYLGLDEEE 77 >ref|XP_007044474.1| Two-component response regulator ARR4 [Theobroma cacao] gi|508708409|gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao] Length = 394 Score = 101 bits (252), Expect = 5e-23 Identities = 54/77 (70%), Positives = 64/77 (83%) Frame = +1 Query: 181 KMAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTA 360 +MA+NG + RR ++ +G D + +DS EVHVLAVDDS VDRKVIERLL+I+SCKVTA Sbjct: 157 EMARNGAVTWRRRTEKIDGFD--LSPSDSEEVHVLAVDDSHVDRKVIERLLRISSCKVTA 214 Query: 361 VDSGRRALQFLGLDEEE 411 VDSGRRALQFLGLDEEE Sbjct: 215 VDSGRRALQFLGLDEEE 231 >ref|XP_012458513.1| PREDICTED: two-component response regulator ARR5-like isoform X1 [Gossypium raimondii] gi|763810252|gb|KJB77154.1| hypothetical protein B456_012G123500 [Gossypium raimondii] Length = 236 Score = 98.6 bits (244), Expect = 7e-23 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG + +R ++ +G D + +D+ EVHVLAVDDSLVDRKVIERLL+I+SCKVTAV Sbjct: 1 MARNGGVAWMRTTEKIDGYD--LSTSDTEEVHVLAVDDSLVDRKVIERLLRISSCKVTAV 58 Query: 364 DSGRRALQFLGLDEE 408 DSGRRALQ+LGLDEE Sbjct: 59 DSGRRALQYLGLDEE 73 >gb|KHG13999.1| Two-component response regulator ARR4 -like protein [Gossypium arboreum] Length = 236 Score = 98.6 bits (244), Expect = 7e-23 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG + +R ++ +G D + +D+ EVHVLAVDDSLVDRKVIERLL+I+SCKVTAV Sbjct: 1 MARNGGVAWMRTTEKIDGYD--LSTSDTEEVHVLAVDDSLVDRKVIERLLRISSCKVTAV 58 Query: 364 DSGRRALQFLGLDEE 408 DSGRRALQ+LGLDEE Sbjct: 59 DSGRRALQYLGLDEE 73 >ref|XP_004297679.1| PREDICTED: two-component response regulator ARR5 [Fragaria vesca subsp. vesca] Length = 240 Score = 98.6 bits (244), Expect = 7e-23 Identities = 53/76 (69%), Positives = 61/76 (80%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+ GV S RR ++ EG+D + S E HVLAVDDSLVDRKVIERLL+I+SCKVTAV Sbjct: 1 MARTGVVSWRRRSEKLEGLD----LSSSEEAHVLAVDDSLVDRKVIERLLRISSCKVTAV 56 Query: 364 DSGRRALQFLGLDEEE 411 DSG RALQFLGLDEE+ Sbjct: 57 DSGMRALQFLGLDEEK 72 >gb|KJB77155.1| hypothetical protein B456_012G123500 [Gossypium raimondii] Length = 244 Score = 98.6 bits (244), Expect = 8e-23 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NG + +R ++ +G D + +D+ EVHVLAVDDSLVDRKVIERLL+I+SCKVTAV Sbjct: 1 MARNGGVAWMRTTEKIDGYD--LSTSDTEEVHVLAVDDSLVDRKVIERLLRISSCKVTAV 58 Query: 364 DSGRRALQFLGLDEE 408 DSGRRALQ+LGLDEE Sbjct: 59 DSGRRALQYLGLDEE 73 >ref|XP_008389572.1| PREDICTED: two-component response regulator ARR5-like [Malus domestica] Length = 236 Score = 97.4 bits (241), Expect = 2e-22 Identities = 55/76 (72%), Positives = 60/76 (78%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA+NGV S RR ++ D S S E HVLAVDDSLVDRKVIERLLKI+SCKVTAV Sbjct: 1 MARNGVVSWRRRSEKL----DLSPPLISEEAHVLAVDDSLVDRKVIERLLKISSCKVTAV 56 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLDEE+ Sbjct: 57 DSGRRALQFLGLDEEK 72 >ref|XP_007223876.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] gi|462420812|gb|EMJ25075.1| hypothetical protein PRUPE_ppa010863mg [Prunus persica] Length = 232 Score = 96.7 bits (239), Expect = 3e-22 Identities = 53/76 (69%), Positives = 63/76 (82%) Frame = +1 Query: 184 MAKNGVFSRLRRLDRAEGVDDFSACNDSHEVHVLAVDDSLVDRKVIERLLKITSCKVTAV 363 MA++GV S RR ++ +G D S N S E HVLAVDDSLVDRKVIERLL+I+SCKVTAV Sbjct: 1 MARSGVVSWRRRSEKLDGFD-MSPMN-SEEAHVLAVDDSLVDRKVIERLLRISSCKVTAV 58 Query: 364 DSGRRALQFLGLDEEE 411 DSGRRALQFLGLD+++ Sbjct: 59 DSGRRALQFLGLDDDK 74