BLASTX nr result
ID: Rehmannia28_contig00029025
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00029025 (347 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095946.1| hypothetical protein L484_023934 [Morus nota... 63 3e-09 ref|XP_010107395.1| hypothetical protein L484_015734 [Morus nota... 53 4e-06 >ref|XP_010095946.1| hypothetical protein L484_023934 [Morus notabilis] gi|587873454|gb|EXB62639.1| hypothetical protein L484_023934 [Morus notabilis] Length = 604 Score = 62.8 bits (151), Expect = 3e-09 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = -2 Query: 340 ESVMGMHTRDSCEPFNETWNSVRAHKRQRIHE--PLKTNTQHELQPAIQKRRDMHRYGEA 167 +S +G+HTRD CEPF++ WN + + I P+ T TQ E I DMH G + Sbjct: 504 DSAVGIHTRDICEPFHDAWNDISDIDNRTIQNRMPVSTETQ-ESMSVIDNWGDMHHRGAS 562 Query: 166 WVNPQADET 140 WVNPQA++T Sbjct: 563 WVNPQAEQT 571 >ref|XP_010107395.1| hypothetical protein L484_015734 [Morus notabilis] gi|587928747|gb|EXC15933.1| hypothetical protein L484_015734 [Morus notabilis] Length = 240 Score = 53.1 bits (126), Expect = 4e-06 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = -2 Query: 340 ESVMGMHTRDSCEPFNETWNSVRAHKRQRIHEPLKTNTQ-HELQPAIQKRRDMHRYGEAW 164 +S +G+HTRD CEPF++ W + ++ I + + +T+ E AI DMHR G++W Sbjct: 74 DSAVGIHTRDICEPFHDAWKDISDMDKRTIQDRMLASTETQEPMSAIDNWADMHRRGDSW 133 Query: 163 V 161 + Sbjct: 134 I 134