BLASTX nr result
ID: Rehmannia28_contig00028932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028932 (311 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087174.1| PREDICTED: alpha-N-acetylglucosaminidase-lik... 74 6e-14 >ref|XP_011087174.1| PREDICTED: alpha-N-acetylglucosaminidase-like [Sesamum indicum] Length = 944 Score = 73.6 bits (179), Expect(2) = 6e-14 Identities = 42/78 (53%), Positives = 49/78 (62%), Gaps = 6/78 (7%) Frame = +2 Query: 95 ISTHTHTLNN--AFFL----HNIYTNPFDSPPTVSGCCHTPSMASLSSSSIFCFTWIPMM 256 + THTH + A FL H IYTNPFDSP T SGC HTP MA +SS CF+ I ++ Sbjct: 76 LHTHTHYTHKKYAHFLRLHNHYIYTNPFDSPSTGSGCFHTPPMAGFASS--LCFSSITVV 133 Query: 257 MMMGLWVFLFLFGINGIP 310 M WV LFLFGIN +P Sbjct: 134 MQ--FWVLLFLFGINWVP 149 Score = 30.4 bits (67), Expect(2) = 6e-14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 52 LSLSPAGNFVFFPCYLHTHTH 114 L LS AG VF YLHTHTH Sbjct: 61 LFLSLAGKSVFIRSYLHTHTH 81