BLASTX nr result
ID: Rehmannia28_contig00028112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00028112 (920 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB46855.1| hypothetical protein B456_008G266200 [Gossypium r... 56 2e-06 >gb|KJB46855.1| hypothetical protein B456_008G266200 [Gossypium raimondii] Length = 132 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 8/48 (16%) Frame = -3 Query: 126 SNDIQSRV-LLKVN-------LFCQVYDVTPFMDDHPGGDEVLLSATG 7 S+ ++SR LK+N L QVYDVTPFMDDHPGGDEVLLSATG Sbjct: 3 SSPLKSRTRYLKLNYCLRLRFLLIQVYDVTPFMDDHPGGDEVLLSATG 50