BLASTX nr result
ID: Rehmannia28_contig00027603
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00027603 (371 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827506.1| PREDICTED: subtilisin-like protease SBT2.5 [... 81 1e-15 ref|XP_011096735.1| PREDICTED: subtilisin-like protease SBT3.5 [... 70 1e-11 >ref|XP_012827506.1| PREDICTED: subtilisin-like protease SBT2.5 [Erythranthe guttata] gi|604299139|gb|EYU19074.1| hypothetical protein MIMGU_mgv1a001321mg [Erythranthe guttata] Length = 840 Score = 81.3 bits (199), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 237 MEGRWGIGLMLCLGIFLGCSYGLDTADNITAVYIVTLKQAPTSHY 371 ME RWGIGL++CLGIF+GCS+ + ADNITAVYIVTLKQAPTSHY Sbjct: 1 MECRWGIGLVVCLGIFVGCSFAQENADNITAVYIVTLKQAPTSHY 45 >ref|XP_011096735.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum] Length = 842 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/48 (70%), Positives = 37/48 (77%), Gaps = 3/48 (6%) Frame = +3 Query: 237 MEGRWGIGL---MLCLGIFLGCSYGLDTADNITAVYIVTLKQAPTSHY 371 MEGRWG+GL ML LG+ +GC Y D AD ITAVYIV LKQAPTSHY Sbjct: 1 MEGRWGVGLIGVMLFLGMLVGCIYAQDNADTITAVYIVILKQAPTSHY 48