BLASTX nr result
ID: Rehmannia28_contig00026894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026894 (300 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containi... 123 8e-31 ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containi... 123 8e-31 ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containi... 115 4e-28 ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containi... 107 3e-25 ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containi... 95 8e-21 ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containi... 95 8e-21 >ref|XP_012853142.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848908341|ref|XP_012853143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 123 bits (309), Expect = 8e-31 Identities = 61/89 (68%), Positives = 70/89 (78%) Frame = -1 Query: 267 DLMGCDFASVVMRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALR 88 D+MGCDF ++ MR+PP+ V+ GILSTF GV RRCSTF P+KN +LYSLGFRSSF TAAL Sbjct: 9 DVMGCDFVTMQMRSPPRIVVEGILSTFCGVHRRCSTFYPTKNHLLYSLGFRSSFSTAALI 68 Query: 87 TTGKPNGEFGYRRNPEKVRPRHESKEPHS 1 TT +PN F RRNPEKVRP HE KE S Sbjct: 69 TTKEPNWGFDSRRNPEKVRPWHELKEAQS 97 >ref|XP_012840386.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] gi|848880003|ref|XP_012840387.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Erythranthe guttata] Length = 999 Score = 123 bits (309), Expect = 8e-31 Identities = 61/89 (68%), Positives = 70/89 (78%) Frame = -1 Query: 267 DLMGCDFASVVMRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALR 88 D+MGCDF ++ MR+PP+ V+ GILSTF GV RRCSTF P+KN +LYSLGFRSSF TAAL Sbjct: 9 DVMGCDFVTMQMRSPPRIVVEGILSTFCGVHRRCSTFYPTKNHLLYSLGFRSSFSTAALI 68 Query: 87 TTGKPNGEFGYRRNPEKVRPRHESKEPHS 1 TT +PN F RRNPEKVRP HE KE S Sbjct: 69 TTKEPNWGFDSRRNPEKVRPWHELKEAQS 97 >ref|XP_012854029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Erythranthe guttata] Length = 999 Score = 115 bits (289), Expect = 4e-28 Identities = 59/89 (66%), Positives = 67/89 (75%) Frame = -1 Query: 267 DLMGCDFASVVMRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALR 88 D+MGCDF S+ MR+PP+ V+ GILS F GV R CSTF P+KN +L SLGFRSSF TAAL Sbjct: 9 DVMGCDFVSMQMRSPPRIVVEGILSNFCGVHRMCSTFYPTKNHLLCSLGFRSSFSTAALI 68 Query: 87 TTGKPNGEFGYRRNPEKVRPRHESKEPHS 1 TT +PN F RRNPEKVR HESKE S Sbjct: 69 TTKEPNWGFDSRRNPEKVRHWHESKEAQS 97 >ref|XP_011087317.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] gi|747080154|ref|XP_011087318.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Sesamum indicum] Length = 1032 Score = 107 bits (268), Expect = 3e-25 Identities = 56/88 (63%), Positives = 61/88 (69%) Frame = -1 Query: 264 LMGCDFASVVMRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALRT 85 LMGC FAS MRN PQ+V GILSTF GVP RCS F + N + YS G RSSF TAALRT Sbjct: 39 LMGCHFASSQMRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFSTAALRT 98 Query: 84 TGKPNGEFGYRRNPEKVRPRHESKEPHS 1 T KP+ EF YRRN EK+ P SKE S Sbjct: 99 TEKPSREFSYRRNREKILPWQASKESQS 126 >ref|XP_011087320.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Sesamum indicum] Length = 984 Score = 95.1 bits (235), Expect = 8e-21 Identities = 49/78 (62%), Positives = 54/78 (69%) Frame = -1 Query: 234 MRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALRTTGKPNGEFGY 55 MRN PQ+V GILSTF GVP RCS F + N + YS G RSSF TAALRTT KP+ EF Y Sbjct: 1 MRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFSTAALRTTEKPSREFSY 60 Query: 54 RRNPEKVRPRHESKEPHS 1 RRN EK+ P SKE S Sbjct: 61 RRNREKILPWQASKESQS 78 >ref|XP_011087319.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Sesamum indicum] Length = 1003 Score = 95.1 bits (235), Expect = 8e-21 Identities = 49/78 (62%), Positives = 54/78 (69%) Frame = -1 Query: 234 MRNPPQSVINGILSTFHGVPRRCSTFLPSKNCILYSLGFRSSFCTAALRTTGKPNGEFGY 55 MRN PQ+V GILSTF GVP RCS F + N + YS G RSSF TAALRTT KP+ EF Y Sbjct: 20 MRNRPQTVFRGILSTFPGVPGRCSAFSLTNNHLFYSFGSRSSFSTAALRTTEKPSREFSY 79 Query: 54 RRNPEKVRPRHESKEPHS 1 RRN EK+ P SKE S Sbjct: 80 RRNREKILPWQASKESQS 97