BLASTX nr result
ID: Rehmannia28_contig00026858
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026858 (514 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMT15885.1| hypothetical protein BVRB_3g055730 [Beta vulgaris... 65 3e-11 emb|CAB89318.1| 40S ribsomomal protein [Arabidopsis thaliana] gi... 65 1e-10 emb|CBI24538.3| unnamed protein product [Vitis vinifera] 65 1e-10 gb|KNA17727.1| hypothetical protein SOVF_077440 [Spinacia oleracea] 65 1e-10 gb|KNA13866.1| hypothetical protein SOVF_112580 [Spinacia oleracea] 65 1e-10 ref|XP_010667811.1| PREDICTED: 40S ribosomal protein S20-2 [Beta... 65 1e-10 ref|XP_010671990.1| PREDICTED: 40S ribosomal protein S20-2 [Beta... 65 1e-10 ref|XP_010546071.1| PREDICTED: 40S ribosomal protein S20-1 [Tare... 65 1e-10 ref|XP_007218610.1| hypothetical protein PRUPE_ppa013457mg [Prun... 65 1e-10 ref|XP_015878354.1| PREDICTED: 40S ribosomal protein S20-2 [Zizi... 65 1e-10 ref|XP_002265347.1| PREDICTED: 40S ribosomal protein S20-2 [Viti... 65 1e-10 gb|KVI11346.1| hypothetical protein Ccrd_010245 [Cynara carduncu... 65 1e-10 ref|XP_013609919.1| PREDICTED: 40S ribosomal protein S20-2 [Bras... 65 1e-10 ref|XP_010108442.1| 40S ribosomal protein S20-2 [Morus notabilis... 65 1e-10 ref|XP_012463744.1| PREDICTED: 40S ribosomal protein S20-2-like ... 65 1e-10 ref|XP_011086523.1| PREDICTED: 40S ribosomal protein S20-2-like ... 65 1e-10 ref|XP_010519067.1| PREDICTED: 40S ribosomal protein S20-2 [Tare... 65 1e-10 ref|XP_010550574.1| PREDICTED: 40S ribosomal protein S20-2 isofo... 65 1e-10 ref|XP_010539950.1| PREDICTED: 40S ribosomal protein S20-2-like ... 65 1e-10 gb|KHF99349.1| 40S ribosomal S20-2 -like protein [Gossypium arbo... 65 1e-10 >gb|KMT15885.1| hypothetical protein BVRB_3g055730 [Beta vulgaris subsp. vulgaris] Length = 64 Score = 65.1 bits (157), Expect = 3e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 32 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 64 >emb|CAB89318.1| 40S ribsomomal protein [Arabidopsis thaliana] gi|8809643|dbj|BAA97194.1| 40S ribosomal protein S20 [Arabidopsis thaliana] gi|23198348|gb|AAN15701.1| 40S ribosomal protein S20 [Arabidopsis thaliana] Length = 117 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 85 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 117 >emb|CBI24538.3| unnamed protein product [Vitis vinifera] Length = 117 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 85 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 117 >gb|KNA17727.1| hypothetical protein SOVF_077440 [Spinacia oleracea] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >gb|KNA13866.1| hypothetical protein SOVF_112580 [Spinacia oleracea] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >ref|XP_010667811.1| PREDICTED: 40S ribosomal protein S20-2 [Beta vulgaris subsp. vulgaris] gi|731377213|ref|XP_010667812.1| PREDICTED: 40S ribosomal protein S20-2 [Beta vulgaris subsp. vulgaris] gi|870841290|gb|KMS95107.1| hypothetical protein BVRB_012430 [Beta vulgaris subsp. vulgaris] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >ref|XP_010671990.1| PREDICTED: 40S ribosomal protein S20-2 [Beta vulgaris subsp. vulgaris] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >ref|XP_010546071.1| PREDICTED: 40S ribosomal protein S20-1 [Tarenaya hassleriana] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >ref|XP_007218610.1| hypothetical protein PRUPE_ppa013457mg [Prunus persica] gi|462415072|gb|EMJ19809.1| hypothetical protein PRUPE_ppa013457mg [Prunus persica] Length = 121 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 89 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 121 >ref|XP_015878354.1| PREDICTED: 40S ribosomal protein S20-2 [Ziziphus jujuba] gi|1009123079|ref|XP_015878355.1| PREDICTED: 40S ribosomal protein S20-2 [Ziziphus jujuba] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_002265347.1| PREDICTED: 40S ribosomal protein S20-2 [Vitis vinifera] gi|731423169|ref|XP_010662389.1| PREDICTED: 40S ribosomal protein S20-2 [Vitis vinifera] gi|147777804|emb|CAN62522.1| hypothetical protein VITISV_002374 [Vitis vinifera] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >gb|KVI11346.1| hypothetical protein Ccrd_010245 [Cynara cardunculus var. scolymus] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_013609919.1| PREDICTED: 40S ribosomal protein S20-2 [Brassica oleracea var. oleracea] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_010108442.1| 40S ribosomal protein S20-2 [Morus notabilis] gi|703145085|ref|XP_010108443.1| 40S ribosomal protein S20-2 [Morus notabilis] gi|587932429|gb|EXC19483.1| 40S ribosomal protein S20-2 [Morus notabilis] gi|587932430|gb|EXC19484.1| 40S ribosomal protein S20-2 [Morus notabilis] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_012463744.1| PREDICTED: 40S ribosomal protein S20-2-like [Gossypium raimondii] gi|823121331|ref|XP_012463830.1| PREDICTED: 40S ribosomal protein S20-2-like [Gossypium raimondii] gi|763740264|gb|KJB07763.1| hypothetical protein B456_001G046200 [Gossypium raimondii] gi|763740266|gb|KJB07765.1| hypothetical protein B456_001G046200 [Gossypium raimondii] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_011086523.1| PREDICTED: 40S ribosomal protein S20-2-like [Sesamum indicum] gi|823182305|ref|XP_012488472.1| PREDICTED: 40S ribosomal protein S20-2-like [Gossypium raimondii] gi|763772236|gb|KJB39359.1| hypothetical protein B456_007G008300 [Gossypium raimondii] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_010519067.1| PREDICTED: 40S ribosomal protein S20-2 [Tarenaya hassleriana] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_010550574.1| PREDICTED: 40S ribosomal protein S20-2 isoform X1 [Tarenaya hassleriana] gi|729382135|ref|XP_010550575.1| PREDICTED: 40S ribosomal protein S20-2 isoform X2 [Tarenaya hassleriana] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >ref|XP_010539950.1| PREDICTED: 40S ribosomal protein S20-2-like [Tarenaya hassleriana] gi|729340646|ref|XP_010539951.1| PREDICTED: 40S ribosomal protein S20-2-like [Tarenaya hassleriana] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122 >gb|KHF99349.1| 40S ribosomal S20-2 -like protein [Gossypium arboreum] Length = 122 Score = 65.1 bits (157), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 475 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 377 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS Sbjct: 90 RVIDLFSSPDVVKQITSITIEPGVEVEVTIADS 122