BLASTX nr result
ID: Rehmannia28_contig00026715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026715 (393 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848582.1| PREDICTED: uncharacterized protein LOC105968... 39 4e-06 >ref|XP_012848582.1| PREDICTED: uncharacterized protein LOC105968491 [Erythranthe guttata] Length = 1307 Score = 39.3 bits (90), Expect(3) = 4e-06 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -2 Query: 392 LEVPSATQDILANALAQGLKDGDFFESL 309 LEVP ++++L NALAQGL+ G+FF+SL Sbjct: 181 LEVPVTSEEVLINALAQGLQMGEFFDSL 208 Score = 33.9 bits (76), Expect(3) = 4e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -3 Query: 292 TFDELLARAEKYINLEEARR 233 +F++LL RAEKYIN EEARR Sbjct: 215 SFNDLLRRAEKYINAEEARR 234 Score = 23.1 bits (48), Expect(3) = 4e-06 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -2 Query: 122 YEKFTPLAAP*GYVFIKIERHPDLR*PNIY 33 +E + PL+ + I HP L+ P Y Sbjct: 247 FENYAPLSTAPSEILTAIVNHPKLKWPRTY 276