BLASTX nr result
ID: Rehmannia28_contig00026530
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026530 (399 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079679.1| PREDICTED: WD repeat-containing protein 89 h... 60 4e-08 ref|XP_008235057.1| PREDICTED: WD repeat-containing protein 89 h... 59 1e-07 ref|XP_011652928.1| PREDICTED: WD repeat-containing protein 89 h... 56 1e-06 ref|XP_008454357.1| PREDICTED: WD repeat-containing protein 89 h... 55 2e-06 ref|XP_008454355.1| PREDICTED: WD repeat-containing protein 89 h... 55 2e-06 ref|XP_008386770.1| PREDICTED: WD repeat-containing protein 89 h... 55 2e-06 ref|XP_008350089.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-co... 55 2e-06 ref|XP_010088504.1| WD repeat-containing protein 89-like protein... 55 2e-06 gb|KVI12505.1| WD40 repeat-containing protein [Cynara cardunculu... 55 3e-06 gb|KYP51017.1| WD repeat-containing protein 89 isogeny [Cajanus ... 54 6e-06 ref|XP_008368998.1| PREDICTED: WD repeat-containing protein 89 h... 54 6e-06 ref|XP_007050892.1| Transducin/WD40 repeat-like superfamily prot... 54 6e-06 >ref|XP_011079679.1| PREDICTED: WD repeat-containing protein 89 homolog [Sesamum indicum] Length = 386 Score = 60.1 bits (144), Expect = 4e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SD+S + N SW+SSTLVEKSP+ RRK RHSPY Sbjct: 352 CWLSDDSTDANRSWVSSTLVEKSPKARRKSRHSPY 386 >ref|XP_008235057.1| PREDICTED: WD repeat-containing protein 89 homolog [Prunus mume] Length = 387 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CWSSDNS E N SWISSTLV +SPRTR +RH PY Sbjct: 353 CWSSDNSPEINRSWISSTLVLRSPRTRHTIRHHPY 387 >ref|XP_011652928.1| PREDICTED: WD repeat-containing protein 89 homolog [Cucumis sativus] gi|700197644|gb|KGN52802.1| hypothetical protein Csa_4G001690 [Cucumis sativus] Length = 391 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CWSSD+S E N SWISSTLV KSP RRK RH PY Sbjct: 357 CWSSDDSYEMNRSWISSTLVIKSPGGRRKNRHHPY 391 >ref|XP_008454357.1| PREDICTED: WD repeat-containing protein 89 homolog isoform X2 [Cucumis melo] Length = 331 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CWSSD+S E N SWISSTLV KSP RRK RH PY Sbjct: 297 CWSSDDSHEMNRSWISSTLVIKSPGGRRKNRHQPY 331 >ref|XP_008454355.1| PREDICTED: WD repeat-containing protein 89 homolog isoform X1 [Cucumis melo] gi|659108725|ref|XP_008454356.1| PREDICTED: WD repeat-containing protein 89 homolog isoform X1 [Cucumis melo] Length = 391 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CWSSD+S E N SWISSTLV KSP RRK RH PY Sbjct: 357 CWSSDDSHEMNRSWISSTLVIKSPGGRRKNRHQPY 391 >ref|XP_008386770.1| PREDICTED: WD repeat-containing protein 89 homolog, partial [Malus domestica] Length = 275 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SDN+ E N SWISSTLV +SPRTR RH PY Sbjct: 241 CWLSDNAPEINRSWISSTLVARSPRTRNTKRHQPY 275 >ref|XP_008350089.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 89 homolog [Malus domestica] Length = 385 Score = 55.1 bits (131), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SDN+ E N SWISSTLV +SPRTR RH PY Sbjct: 351 CWLSDNAPEINRSWISSTLVARSPRTRNTKRHQPY 385 >ref|XP_010088504.1| WD repeat-containing protein 89-like protein [Morus notabilis] gi|587845881|gb|EXB36417.1| WD repeat-containing protein 89-like protein [Morus notabilis] Length = 387 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SD+S E + SWISSTLV KSP+ R+K+RH PY Sbjct: 353 CWLSDDSSEIDRSWISSTLVMKSPKNRKKIRHQPY 387 >gb|KVI12505.1| WD40 repeat-containing protein [Cynara cardunculus var. scolymus] Length = 352 Score = 54.7 bits (130), Expect = 3e-06 Identities = 21/35 (60%), Positives = 28/35 (80%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SD+S + N+SWIS++LVEK P+ RR+ RH PY Sbjct: 318 CWLSDDSCDVNHSWISTSLVEKHPKNRRRKRHQPY 352 >gb|KYP51017.1| WD repeat-containing protein 89 isogeny [Cajanus cajan] Length = 383 Score = 53.9 bits (128), Expect = 6e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SD+S E+N SWISSTLV K RTR+K RH PY Sbjct: 349 CWLSDDSSESNQSWISSTLVMKPERTRKKNRHHPY 383 >ref|XP_008368998.1| PREDICTED: WD repeat-containing protein 89 homolog [Malus domestica] Length = 385 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW SDN+ E N SWISS LV +SPRTR RH PY Sbjct: 351 CWLSDNAPEINRSWISSALVSRSPRTRNTTRHQPY 385 >ref|XP_007050892.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508703153|gb|EOX95049.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 415 Score = 53.9 bits (128), Expect = 6e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = +2 Query: 2 CWSSDNSIETNYSWISSTLVEKSPRTRRKLRHSPY 106 CW +D+S E N SWISS LV KSPR R+K RH+PY Sbjct: 381 CWMADDSSEINRSWISSALVIKSPRNRKKSRHNPY 415