BLASTX nr result
ID: Rehmannia28_contig00026510
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026510 (320 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838513.1| PREDICTED: internal alternative NAD(P)H-ubiq... 81 9e-16 ref|XP_011090313.1| PREDICTED: internal alternative NAD(P)H-ubiq... 69 2e-11 >ref|XP_012838513.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like [Erythranthe guttata] gi|604331181|gb|EYU36039.1| hypothetical protein MIMGU_mgv1a004976mg [Erythranthe guttata] Length = 502 Score = 80.9 bits (198), Expect = 9e-16 Identities = 39/64 (60%), Positives = 49/64 (76%), Gaps = 4/64 (6%) Frame = +3 Query: 141 MPWLRNFIQLSATFTRRGLPPPRKPSA-VFG---PPPSIAQLLQHFSSAAQSTDPGLGPT 308 MPWLRNF+QLSA++ R+ PPP K +A +FG P PS+ QLL+HFS+ +Q T PGL PT Sbjct: 1 MPWLRNFLQLSASYARQSPPPPHKSAAAIFGRASPAPSLTQLLRHFSAGSQVTYPGLAPT 60 Query: 309 KGDE 320 KGDE Sbjct: 61 KGDE 64 >ref|XP_011090313.1| PREDICTED: internal alternative NAD(P)H-ubiquinone oxidoreductase A1, mitochondrial-like [Sesamum indicum] Length = 501 Score = 68.6 bits (166), Expect = 2e-11 Identities = 36/63 (57%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = +3 Query: 141 MPWLRNFIQLSATFTRRG--LPPPRKPSAVFGP-PPSIAQLLQHFSSAAQSTDPGLGPTK 311 MPW RNFIQLSATF+++ P R +A+F PS+ QLL+HFS+ Q PGLGPTK Sbjct: 1 MPWFRNFIQLSATFSKQSPSSSPRRAAAAIFVTRSPSLTQLLRHFSTHPQEKYPGLGPTK 60 Query: 312 GDE 320 GDE Sbjct: 61 GDE 63