BLASTX nr result
ID: Rehmannia28_contig00026395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026395 (313 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphat... 64 1e-09 ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphat... 62 3e-09 >ref|XP_011082963.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] gi|747072128|ref|XP_011082964.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Sesamum indicum] Length = 500 Score = 63.5 bits (153), Expect = 1e-09 Identities = 35/61 (57%), Positives = 36/61 (59%) Frame = +2 Query: 131 DNLTNKDKRVGIRREPSFSGWCDEDGIPRPARLIXXXXXXXXXXXXLPLVQPHRPENKVL 310 D LT +DK V I REPSFSGW DEDGIP PARL L LVQP EN VL Sbjct: 18 DLLTREDKSVRISREPSFSGWFDEDGIPLPARLRNDEVNEEDFVFRLHLVQPQGSENGVL 77 Query: 311 D 313 D Sbjct: 78 D 78 >ref|XP_012844322.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888228|ref|XP_012844323.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|848888231|ref|XP_012844324.1| PREDICTED: probable sugar phosphate/phosphate translocator At1g06470 [Erythranthe guttata] gi|604320855|gb|EYU31629.1| hypothetical protein MIMGU_mgv1a005699mg [Erythranthe guttata] Length = 474 Score = 62.0 bits (149), Expect = 3e-09 Identities = 31/57 (54%), Positives = 35/57 (61%) Frame = +2 Query: 143 NKDKRVGIRREPSFSGWCDEDGIPRPARLIXXXXXXXXXXXXLPLVQPHRPENKVLD 313 +K KR+GIRREPSFSGW DEDGIP P++LI LPL Q EN LD Sbjct: 15 SKVKRIGIRREPSFSGWYDEDGIPYPSQLINDEVNVEEFDFNLPLAQTRSSENDSLD 71