BLASTX nr result
ID: Rehmannia28_contig00026328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026328 (368 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 77 1e-15 ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AI... 76 2e-15 ref|XP_014509064.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 77 2e-15 ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 76 3e-15 ref|NP_001235027.1| uncharacterized protein LOC100500229 precurs... 75 3e-15 ref|XP_006367623.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 75 4e-15 dbj|BAT75869.1| hypothetical protein VIGAN_01379800 [Vigna angul... 76 4e-15 emb|CDP09931.1| unnamed protein product [Coffea canephora] 75 4e-15 gb|KOM32599.1| hypothetical protein LR48_Vigan01g215500 [Vigna a... 76 6e-15 ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 75 7e-15 ref|XP_011081223.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 75 8e-15 ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.1... 75 8e-15 gb|KYP72195.1| 14 kDa proline-rich protein DC2.15, partial [Caja... 73 8e-15 gb|KRH04106.1| hypothetical protein GLYMA_17G140300 [Glycine max] 74 9e-15 gb|KHN09805.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] 74 9e-15 ref|NP_001235511.1| uncharacterized protein LOC100500518 precurs... 74 9e-15 ref|NP_001235888.1| uncharacterized protein LOC100500033 precurs... 74 9e-15 ref|NP_001238461.1| uncharacterized protein LOC100499693 precurs... 74 9e-15 gb|KHN04353.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] 74 9e-15 ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citr... 74 9e-15 >ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus grandis] gi|629106849|gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis] Length = 135 Score = 76.6 bits (187), Expect = 1e-15 Identities = 42/68 (61%), Positives = 47/68 (69%), Gaps = 1/68 (1%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTC-RITP 190 +NV VGK GLVDLEAAVC CTAIKA++LGIN N+PISLSLLLN C + P Sbjct: 70 LNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINLNIPISLSLLLNVCSKQVP 129 Query: 189 PRFGFVCA 166 P GF CA Sbjct: 130 P--GFKCA 135 >ref|XP_010455702.1| PREDICTED: putative lipid-binding protein AIR1 [Camelina sativa] Length = 131 Score = 76.3 bits (186), Expect = 2e-15 Identities = 40/66 (60%), Positives = 45/66 (68%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VNV +G GLVDLEAAVC CTA+KAS+LGIN N+PI+LSLLLN C PP Sbjct: 66 VNVTLGAPPVKPCCSLIDGLVDLEAAVCLCTALKASILGININLPINLSLLLNVCSRKPP 125 Query: 186 RFGFVC 169 R GF C Sbjct: 126 R-GFQC 130 >ref|XP_014509064.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Vigna radiata var. radiata] Length = 172 Score = 77.0 bits (188), Expect = 2e-15 Identities = 39/67 (58%), Positives = 47/67 (70%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VNV +G+ GLVDLEAAVC CTA++A++LGIN N+PISLSLLLN C I PP Sbjct: 107 VNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINLNLPISLSLLLNVCSIQPP 166 Query: 186 RFGFVCA 166 R F C+ Sbjct: 167 R-NFQCS 172 >ref|XP_011076346.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum] Length = 152 Score = 76.3 bits (186), Expect = 3e-15 Identities = 41/65 (63%), Positives = 45/65 (69%) Frame = -3 Query: 360 VEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPPRF 181 V VG AGLVDLEAAVC CTAIKA+VLGIN N+P+SLSLLLN C TPP Sbjct: 89 VVVGNPPTTPCCSLLAGLVDLEAAVCLCTAIKANVLGINLNIPVSLSLLLNACGRTPPT- 147 Query: 180 GFVCA 166 GF C+ Sbjct: 148 GFTCS 152 >ref|NP_001235027.1| uncharacterized protein LOC100500229 precursor [Glycine max] gi|255629766|gb|ACU15232.1| unknown [Glycine max] gi|734341636|gb|KHN09804.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] gi|947054652|gb|KRH04105.1| hypothetical protein GLYMA_17G140200 [Glycine max] Length = 131 Score = 75.5 bits (184), Expect = 3e-15 Identities = 39/67 (58%), Positives = 46/67 (68%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP+ LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVKLSLLLNYCGKGVP 125 Query: 186 RFGFVCA 166 + GFVCA Sbjct: 126 K-GFVCA 131 >ref|XP_006367623.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum] Length = 125 Score = 75.1 bits (183), Expect = 4e-15 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VNV VG GLVDLEAAVC CTAI+A+VLGIN N+P+SLSL+LN C PP Sbjct: 61 VNVVVGSPPTLPCCSLIQGLVDLEAAVCLCTAIRANVLGINLNIPLSLSLVLNNCGRNPP 120 Query: 186 RFGFVC 169 GF C Sbjct: 121 T-GFTC 125 >dbj|BAT75869.1| hypothetical protein VIGAN_01379800 [Vigna angularis var. angularis] Length = 154 Score = 75.9 bits (185), Expect = 4e-15 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VNV +G+ GLVDLEAAVC CTA++A++LGIN N+PISL+LLLN C I PP Sbjct: 89 VNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINLNLPISLTLLLNVCSIQPP 148 Query: 186 RFGFVCA 166 R F C+ Sbjct: 149 R-NFQCS 154 >emb|CDP09931.1| unnamed protein product [Coffea canephora] Length = 129 Score = 75.1 bits (183), Expect = 4e-15 Identities = 37/67 (55%), Positives = 45/67 (67%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +N+ +G GL DLEAAVC CTAIKA++LGIN N+P+SLSLLLN C P Sbjct: 64 LNITIGNPPKKPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCSKNVP 123 Query: 186 RFGFVCA 166 + GFVCA Sbjct: 124 K-GFVCA 129 >gb|KOM32599.1| hypothetical protein LR48_Vigan01g215500 [Vigna angularis] Length = 169 Score = 75.9 bits (185), Expect = 6e-15 Identities = 38/67 (56%), Positives = 47/67 (70%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VNV +G+ GLVDLEAAVC CTA++A++LGIN N+PISL+LLLN C I PP Sbjct: 104 VNVTLGQPPVTPCCSLLNGLVDLEAAVCLCTALRANILGINLNLPISLTLLLNVCSIQPP 163 Query: 186 RFGFVCA 166 R F C+ Sbjct: 164 R-NFQCS 169 >ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus grandis] gi|629112791|gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis] Length = 134 Score = 74.7 bits (182), Expect = 7e-15 Identities = 41/67 (61%), Positives = 44/67 (65%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 VN+ VG GL DLEAAVC CTAIKASVLGIN NVP+SLSLLLN C P Sbjct: 69 VNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLGINLNVPVSLSLLLNYCGKDVP 128 Query: 186 RFGFVCA 166 +GF CA Sbjct: 129 -YGFQCA 134 >ref|XP_011081223.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum] Length = 137 Score = 74.7 bits (182), Expect = 8e-15 Identities = 37/67 (55%), Positives = 46/67 (68%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 V E+G GL+DLEAAVC CTA+KA++LGIN N+PISLSLL+NTC T P Sbjct: 72 VGTEIGSPPDHPCCSALGGLLDLEAAVCLCTALKANILGINLNIPISLSLLINTCGKTLP 131 Query: 186 RFGFVCA 166 + F+CA Sbjct: 132 K-DFICA 137 >ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica] Length = 137 Score = 74.7 bits (182), Expect = 8e-15 Identities = 38/67 (56%), Positives = 45/67 (67%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +N+ +GK GL DLEAAVC CTAIKA++LGIN N+PISLSLLLN C P Sbjct: 72 LNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGINLNIPISLSLLLNVCGNKVP 131 Query: 186 RFGFVCA 166 + GF CA Sbjct: 132 K-GFQCA 137 >gb|KYP72195.1| 14 kDa proline-rich protein DC2.15, partial [Cajanus cajan] Length = 83 Score = 73.2 bits (178), Expect = 8e-15 Identities = 38/67 (56%), Positives = 46/67 (68%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV +G+ GLVDLEAAVC CTA++A++LGIN N+PISLSLLLN C P Sbjct: 18 LNVTLGQPPVTPCCTLLNGLVDLEAAVCLCTALRANILGINLNLPISLSLLLNVCSRQVP 77 Query: 186 RFGFVCA 166 R GF CA Sbjct: 78 R-GFQCA 83 >gb|KRH04106.1| hypothetical protein GLYMA_17G140300 [Glycine max] Length = 131 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 125 Query: 186 RFGFVC 169 + GFVC Sbjct: 126 K-GFVC 130 >gb|KHN09805.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] Length = 131 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 125 Query: 186 RFGFVC 169 + GFVC Sbjct: 126 K-GFVC 130 >ref|NP_001235511.1| uncharacterized protein LOC100500518 precursor [Glycine max] gi|255630522|gb|ACU15619.1| unknown [Glycine max] gi|734341638|gb|KHN09806.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] gi|947054654|gb|KRH04107.1| hypothetical protein GLYMA_17G140400 [Glycine max] Length = 131 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCSLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 125 Query: 186 RFGFVC 169 + GFVC Sbjct: 126 K-GFVC 130 >ref|NP_001235888.1| uncharacterized protein LOC100500033 precursor [Glycine max] gi|255628645|gb|ACU14667.1| unknown [Glycine max] Length = 131 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 125 Query: 186 RFGFVC 169 + GFVC Sbjct: 126 K-GFVC 130 >ref|NP_001238461.1| uncharacterized protein LOC100499693 precursor [Glycine max] gi|255625839|gb|ACU13264.1| unknown [Glycine max] gi|343489105|gb|AEM45873.1| proline-rich protein [Glycine max] Length = 131 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 66 INVQLGKPPKTPCCNLIEGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 125 Query: 186 RFGFVC 169 + GFVC Sbjct: 126 K-GFVC 130 >gb|KHN04353.1| 14 kDa proline-rich protein DC2.15 [Glycine soja] Length = 132 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/66 (57%), Positives = 46/66 (69%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV++GK GL DLEAAVC CTA+KA+VLGIN NVP++LSLLLN C P Sbjct: 67 INVQLGKPPKTPCCNLIQGLADLEAAVCLCTALKANVLGINLNVPVNLSLLLNYCGKGVP 126 Query: 186 RFGFVC 169 + GFVC Sbjct: 127 K-GFVC 131 >ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina] gi|568846802|ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Citrus sinensis] gi|557542609|gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina] gi|641842581|gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis] Length = 132 Score = 74.3 bits (181), Expect = 9e-15 Identities = 38/67 (56%), Positives = 45/67 (67%) Frame = -3 Query: 366 VNVEVGKXXXXXXXXXXAGLVDLEAAVCFCTAIKASVLGINRNVPISLSLLLNTCRITPP 187 +NV +G GL DLEAAVC CTAIKA++LGIN N+P+SLSLLLN C + P Sbjct: 67 LNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGINLNIPLSLSLLLNVCSKSVP 126 Query: 186 RFGFVCA 166 R GF CA Sbjct: 127 R-GFQCA 132