BLASTX nr result
ID: Rehmannia28_contig00026020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00026020 (391 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096740.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesa... 117 5e-29 ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Eryt... 110 4e-26 ref|XP_002529901.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Rici... 107 5e-25 ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prun... 105 1e-24 ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prun... 105 1e-24 ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 2e-24 ref|XP_015066113.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 105 2e-24 ref|XP_006353041.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 105 2e-24 ref|XP_008383446.1| PREDICTED: probable UDP-arabinose 4-epimeras... 100 3e-24 gb|KDP34859.1| hypothetical protein JCGZ_09147 [Jatropha curcas] 104 3e-24 ref|XP_012075532.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 104 4e-24 ref|XP_010315644.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 4e-24 ref|XP_008459120.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 104 5e-24 ref|XP_010315643.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 6e-24 emb|CDP12630.1| unnamed protein product [Coffea canephora] 103 7e-24 ref|XP_015063999.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 103 7e-24 ref|XP_004231574.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 7e-24 ref|XP_004233189.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sola... 103 7e-24 ref|XP_015168656.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 103 1e-23 ref|XP_006356905.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 103 1e-23 >ref|XP_011096740.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097544|ref|XP_011096741.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097546|ref|XP_011096742.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] gi|747097548|ref|XP_011096743.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Sesamum indicum] Length = 417 Score = 117 bits (294), Expect = 5e-29 Identities = 52/59 (88%), Positives = 56/59 (94%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEVYSDP+KIKNELNWTAKHT+LQ+SLQ+AWRWQKAHLNGY PLVMSA Sbjct: 359 DFLPRRPGDYAEVYSDPTKIKNELNWTAKHTDLQESLQVAWRWQKAHLNGYGTPLVMSA 417 >ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] gi|848927803|ref|XP_012827592.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] gi|848927807|ref|XP_012827593.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] gi|604299135|gb|EYU19070.1| hypothetical protein MIMGU_mgv1a007125mg [Erythranthe guttata] Length = 418 Score = 110 bits (274), Expect = 4e-26 Identities = 52/60 (86%), Positives = 56/60 (93%), Gaps = 1/60 (1%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGY-EAPLVMSA 178 D LPRRPGDYAEVYS+P+KI +ELNWTAK+TNLQQSLQIAWRWQKAHLNGY APLVMSA Sbjct: 359 DFLPRRPGDYAEVYSNPTKINSELNWTAKYTNLQQSLQIAWRWQKAHLNGYGGAPLVMSA 418 >ref|XP_002529901.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] gi|1000945442|ref|XP_015581283.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] gi|1000945444|ref|XP_015581284.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] gi|223530628|gb|EEF32504.1| UDP-glucose 4-epimerase, putative [Ricinus communis] Length = 417 Score = 107 bits (266), Expect = 5e-25 Identities = 46/59 (77%), Positives = 55/59 (93%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEVYSDP+KI+ ELNWTA+HT+LQ+SLQ+AWRWQKAH NGY +PLVM++ Sbjct: 359 DYLPRRPGDYAEVYSDPTKIRVELNWTAQHTDLQESLQVAWRWQKAHRNGYGSPLVMAS 417 >ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prunus mume] Length = 417 Score = 105 bits (263), Expect = 1e-24 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVM 172 D LPRRPGDYAEVYSDPSKI ELNWTA+HTNLQ+SLQ+AWRWQK+H +GY PLVM Sbjct: 359 DFLPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGYGTPLVM 415 >ref|XP_007211748.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|462407613|gb|EMJ12947.1| hypothetical protein PRUPE_ppa006315mg [Prunus persica] gi|464895971|gb|AGH25534.1| UDP-D-xylose 4-epimerase [Prunus persica] Length = 417 Score = 105 bits (263), Expect = 1e-24 Identities = 46/57 (80%), Positives = 51/57 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVM 172 D LPRRPGDYAEVYSDPSKI ELNWTA+HTNLQ+SLQ+AWRWQK+H +GY PLVM Sbjct: 359 DFLPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGYGTPLVM 415 >ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X4 [Solanum lycopersicum] Length = 305 Score = 103 bits (258), Expect = 2e-24 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 175 + LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 248 EFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 305 >ref|XP_015066113.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] gi|970010442|ref|XP_015066114.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] Length = 417 Score = 105 bits (262), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+SDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGY + LV S+ Sbjct: 359 DFLPRRPGDYAEVFSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYGSSLVKSS 417 >ref|XP_006353041.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum tuberosum] gi|565372938|ref|XP_006353042.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum tuberosum] gi|971560311|ref|XP_015166656.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum tuberosum] Length = 417 Score = 105 bits (262), Expect = 2e-24 Identities = 46/59 (77%), Positives = 54/59 (91%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+SDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGY + LV S+ Sbjct: 359 DFLPRRPGDYAEVFSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYGSSLVKSS 417 >ref|XP_008383446.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 [Malus domestica] Length = 170 Score = 100 bits (248), Expect = 3e-24 Identities = 45/60 (75%), Positives = 53/60 (88%), Gaps = 1/60 (1%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEA-PLVMSA 178 D LPRRPGDYAEV+SDPSKI ELNW+A+HTNLQ+SLQ+AWRWQKAH +GY PLV+S+ Sbjct: 111 DFLPRRPGDYAEVFSDPSKILRELNWSAQHTNLQESLQVAWRWQKAHRDGYGTNPLVLSS 170 >gb|KDP34859.1| hypothetical protein JCGZ_09147 [Jatropha curcas] Length = 401 Score = 104 bits (260), Expect = 3e-24 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+SDP+KI+ ELNWTA+HT+LQ+SLQIAWRWQK+H NGY +PLVM++ Sbjct: 343 DYLPRRPGDYAEVFSDPTKIRLELNWTAQHTDLQESLQIAWRWQKSHRNGYGSPLVMAS 401 >ref|XP_012075532.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Jatropha curcas] gi|802620036|ref|XP_012075533.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Jatropha curcas] Length = 417 Score = 104 bits (260), Expect = 4e-24 Identities = 45/59 (76%), Positives = 55/59 (93%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+SDP+KI+ ELNWTA+HT+LQ+SLQIAWRWQK+H NGY +PLVM++ Sbjct: 359 DYLPRRPGDYAEVFSDPTKIRLELNWTAQHTDLQESLQIAWRWQKSHRNGYGSPLVMAS 417 >ref|XP_010315644.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X3 [Solanum lycopersicum] gi|723667920|ref|XP_010315645.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X3 [Solanum lycopersicum] Length = 365 Score = 103 bits (258), Expect = 4e-24 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 175 + LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 308 EFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 365 >ref|XP_008459120.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Cucumis melo] gi|659118442|ref|XP_008459121.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Cucumis melo] Length = 417 Score = 104 bits (259), Expect = 5e-24 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+S+P+KIKNELNWTA+HT+LQ+SL +AWRWQK+HLNGY LVMS+ Sbjct: 359 DYLPRRPGDYAEVFSNPTKIKNELNWTAQHTDLQESLSVAWRWQKSHLNGYGNSLVMSS 417 >ref|XP_010315643.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X2 [Solanum lycopersicum] Length = 395 Score = 103 bits (258), Expect = 6e-24 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 175 + LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 338 EFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 395 >emb|CDP12630.1| unnamed protein product [Coffea canephora] Length = 415 Score = 103 bits (258), Expect = 7e-24 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAP 163 D LPRRPGDYAEVYSDP+KI+ ELNWTAK+TNLQ+SL++AWRWQKAH+NGY P Sbjct: 359 DYLPRRPGDYAEVYSDPTKIRTELNWTAKYTNLQESLRVAWRWQKAHINGYSTP 412 >ref|XP_015063999.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Solanum pennellii] Length = 416 Score = 103 bits (258), Expect = 7e-24 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 175 + LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 359 EFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 416 >ref|XP_004231574.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X1 [Solanum lycopersicum] Length = 416 Score = 103 bits (258), Expect = 7e-24 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 175 + LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 359 EFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 416 >ref|XP_004233189.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Solanum lycopersicum] gi|723676130|ref|XP_010316982.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Solanum lycopersicum] gi|723676133|ref|XP_010316983.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Solanum lycopersicum] Length = 417 Score = 103 bits (258), Expect = 7e-24 Identities = 45/59 (76%), Positives = 54/59 (91%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 178 D LPRRPGDYAEV+SDP+KIK ELNWTA+HT+LQ+SLQ+AWRWQK+HLNGY + LV S+ Sbjct: 359 DFLPRRPGDYAEVFSDPTKIKLELNWTAQHTDLQESLQVAWRWQKSHLNGYGSSLVKSS 417 >ref|XP_015168656.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Solanum tuberosum] Length = 417 Score = 103 bits (257), Expect = 1e-23 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGY 154 D LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQ+SLQIAWRWQK+HLNGY Sbjct: 358 DFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQESLQIAWRWQKSHLNGY 408 >ref|XP_006356905.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Solanum tuberosum] Length = 418 Score = 103 bits (257), Expect = 1e-23 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = +2 Query: 2 DLLPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGY 154 D LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQ+SLQIAWRWQK+HLNGY Sbjct: 359 DFLPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQESLQIAWRWQKSHLNGY 409