BLASTX nr result
ID: Rehmannia28_contig00025566
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00025566 (306 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98463.1| unnamed protein product [Coffea canephora] 59 1e-09 >emb|CDO98463.1| unnamed protein product [Coffea canephora] Length = 64 Score = 58.5 bits (140), Expect = 1e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 171 LKYKEMWNERLKKYEEEMNKRKIQEAESNEFQE 269 LKYKEMWNERLKKYEEE+N++KI E +SNEFQE Sbjct: 31 LKYKEMWNERLKKYEEELNRKKIAE-QSNEFQE 62