BLASTX nr result
ID: Rehmannia28_contig00023390
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00023390 (356 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093665.1| PREDICTED: gamma-glutamyltranspeptidase 3 [S... 65 5e-10 >ref|XP_011093665.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Sesamum indicum] gi|747091841|ref|XP_011093666.1| PREDICTED: gamma-glutamyltranspeptidase 3 [Sesamum indicum] Length = 623 Score = 65.1 bits (157), Expect = 5e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +1 Query: 238 MGQEGLEASLLASDGNSSRKKRRWSRALWFLFLALIAVA 354 MGQEG EASLL SDGNSSRK RRWSRALW LFLAL+A++ Sbjct: 1 MGQEGYEASLLGSDGNSSRK-RRWSRALWLLFLALVAIS 38